SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g11310

Feature Type:gene_model
Chromosome:Gm17
Start:8500345
stop:8501219
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g11310
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G46490AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G35110.1); Has 34 Blast hits to 34 proteins in 7 species: Archae - 0; Bacteria - 0; Metazoa - 1; Fungi - 0; Plants - 33; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:19079457-19079861 FORWARD LENGTH=134 SoyBaseE_val: 3.00E-18ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_C6SYV5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SYV5_SOYBN SoyBaseE_val: 4.00E-74ISS
UniRef100_Q9FYR1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Gb|AAD20160.1 n=1 Tax=Arabidopsis thaliana RepID=Q9FYR1_ARATH SoyBaseE_val: 5.00E-11ISS

Expression Patterns of Glyma17g11310
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g11310
ParalogEvidenceComments
Glyma13g22500 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g11310 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g104600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g11310
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g11310
>Glyma17g11310.1   sequence type=CDS   gene model=Glyma17g11310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAACTGGTGCCGCCCCAGATGGATTATTCTGGTCAGTGGTGTATGAAGGGTGCATATCTGGCTATGATAACTGCGTGGAACGACGACCCTACCACCGTAACTGTGGCTGTGCACTCCATAACACGTCACTTATTAATCGCACGCACAAGCTTCCGAGGTGTAACAATGTGTCATACCCTATGAGGAGGGCATGGAGTGAAGGAAGCTTGGTCTTGGCAACTTCTTCTTCTTCATCATCTCCTTCTCAAGTTGCAACTGGGGGAAGGCCACAACCAAGTTTGGCAAACGTTGAGGAGGAAAATAAGAATTGCTTTAATTATTGA
Predicted protein sequences of Glyma17g11310
>Glyma17g11310.1   sequence type=predicted peptide   gene model=Glyma17g11310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATGAAPDGLFWSVVYEGCISGYDNCVERRPYHRNCGCALHNTSLINRTHKLPRCNNVSYPMRRAWSEGSLVLATSSSSSSPSQVATGGRPQPSLANVEEENKNCFNY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo