SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g11201

Feature Type:gene_model
Chromosome:Gm17
Start:8417325
stop:8418507
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g11201
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G80710AT Annotation by Michelle Graham. TAIR10: DROUGHT SENSITIVE 1 | chr1:30333499-30335796 REVERSE LENGTH=516 SoyBaseE_val: 5.00E-21ISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0080008GO-cc Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
UniRef100_I1MTX7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MTX7_SOYBN SoyBaseE_val: 8.00E-87ISS
UniRef100_Q9SAI7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Drought-sensitive 1 protein n=1 Tax=Arabidopsis thaliana RepID=Q9SAI7_ARATH SoyBaseE_val: 2.00E-18ISS

Expression Patterns of Glyma17g11201
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g11201 not represented in the dataset
Glyma17g11201 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g11201 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma17g11201
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g11201
>Glyma17g11201.1   sequence type=CDS   gene model=Glyma17g11201   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGATATACACTAGTTGCTATGATGGAATTCTTCGGCTAATGGATACTGAGAAGGAAATCTTTGATCTGGTATTTGAGAGTGACGAAAGTATATATGCTCTCTCTCAATCAACAAATGAGACAAACTGCCTATATCTTGGTGAGGGTTCTGGTGCCTGCACCTGGGATTTGAGATATACTGATGGGGATAAACTTGCCGCCTTGAGAATATTTACCCACAAAAGAGGTGTGCAATCTGCTTACTTCTCTCCTTCTGGATGTAGCCTGGCAACTACAAGCAGTTCAAAGGAAGCAGTTATGACTCTTGCGAGCCCGCACATGTCTGTCAATCCGTACAGATTAGATAGACATTCATACGAGGTTGGGATGCTTGTAGGATGTACAAGTGGAGGCCAGGTTTGTATTTGGATGTCGCTCTAG
Predicted protein sequences of Glyma17g11201
>Glyma17g11201.1   sequence type=predicted peptide   gene model=Glyma17g11201   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQIYTSCYDGILRLMDTEKEIFDLVFESDESIYALSQSTNETNCLYLGEGSGACTWDLRYTDGDKLAALRIFTHKRGVQSAYFSPSGCSLATTSSSKEAVMTLASPHMSVNPYRLDRHSYEVGMLVGCTSGGQVCIWMSL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo