SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g11180

Feature Type:gene_model
Chromosome:Gm17
Start:8401780
stop:8407153
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g11180
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G15860AT Annotation by Michelle Graham. TAIR10: Domain of unknown function (DUF298) | chr1:5455055-5456741 FORWARD LENGTH=227 SoyBaseE_val: 2.00E-89ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
KOG3077 KOG Uncharacterized conserved protein JGI ISS
PTHR12281Panther RP42 RELATED JGI ISS
PF03556PFAM Domain of unknown function (DUF298) JGI ISS
UniRef100_B9SMU9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Defective in cullin neddylation protein, putative n=1 Tax=Ricinus communis RepID=B9SMU9_RICCO SoyBaseE_val: 1.00E-88ISS
UniRef100_I1MTX5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MTX5_SOYBN SoyBaseE_val: 9.00E-167ISS

Expression Patterns of Glyma17g11180
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g11180
ParalogEvidenceComments
Glyma13g22360 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g11180 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g103600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g11180
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g11180
>Glyma17g11180.1   sequence type=CDS   gene model=Glyma17g11180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTCGTCCCAAAAGAAAAGCTGCCCCACCAATCACTTCCTCTGATGTTGATTCTTCTCTTCGCACCGAACCAAAGAAATCAACTACAAAGCAATTTGATCGAATAGATAACTTATTTGAGTCATATGCAAATAAGTCATTGGGTTTAATTGACCCAGACGGGATTGAAGCACTTTGTAAAGATGTGCATGTGGACCACACAGATGTTAGAATGCTCATACTTGCTTGGAAATTGAAAGCTGAAAAACAAGGTTATTTTTCCAAGGATGAGTGGCGAAAAGGGCTCAAATGTTTAGGGGCTGACACTCTTCCAAAATTAAGAAAGGCTATTAATGGACTGAAGAAAGAGGTGACGGTACCAGAGTGCTTTGAGGATTTTTATTCCTATGCATTTCAATACTGTTTAACAGAAGAAAAGCAAAGGAGTATAGATATTGAGACCATCTGTGAGCTGTTGAATGTCGTTCTTAGATCTGAATTTCCTACTCAAGTCAATTTATTAACTGAGTATCTAAAGATCCAGAACGATTACAGGGCACTAAACATAGATCACTGGAGAAATTTTTATCGGTTTTTTAAGGAGGTAAGCCTTATTGATCTTCGAAGTTATGACTCCAGTCAGGCATGGCCAGTGATCCTCGACAATTTTGTTGATTGGTTAAAAGAAAAAGAAGAGAAAATATAG
Predicted protein sequences of Glyma17g11180
>Glyma17g11180.1   sequence type=predicted peptide   gene model=Glyma17g11180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPRPKRKAAPPITSSDVDSSLRTEPKKSTTKQFDRIDNLFESYANKSLGLIDPDGIEALCKDVHVDHTDVRMLILAWKLKAEKQGYFSKDEWRKGLKCLGADTLPKLRKAINGLKKEVTVPECFEDFYSYAFQYCLTEEKQRSIDIETICELLNVVLRSEFPTQVNLLTEYLKIQNDYRALNIDHWRNFYRFFKEVSLIDLRSYDSSQAWPVILDNFVDWLKEKEEKI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo