Glyma17g10730 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g10730

Feature Type:	gene_model
Chromosome:	Gm17
Start:	8065940
stop:	8068228
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g10730

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G74520	AT	Annotation by Michelle Graham. TAIR10: HVA22 homologue A \| chr1:28008109-28009156 REVERSE LENGTH=177	SoyBase	E_val: 9.00E-89	ISS
GO:0009269	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to desiccation	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0042538	GO-bp	Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response	SoyBase	N/A	ISS
GO:0042742	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG1725	KOG	Protein involved in membrane traffic (YOP1/TB2/DP1/HVA22 family)	JGI		ISS
PTHR12300	Panther	HVA22-LIKE PROTEINS	JGI		ISS
PTHR12300:SF11	Panther	HVA22-LIKE PROTEIN	JGI		ISS
PF03134	PFAM	TB2/DP1, HVA22 family	JGI		ISS
UniRef100_G7JQY1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: HVA22-like protein a n=1 Tax=Medicago truncatula RepID=G7JQY1_MEDTR	SoyBase	E_val: 3.00E-100	ISS
UniRef100_I1MTS6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MTS6_SOYBN	SoyBase	E_val: 1.00E-120	ISS

Expression Patterns of Glyma17g10730

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g10730

Paralog	Evidence	Comments
Glyma05g01160	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g10730 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g098800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g10730

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g10730

Limit To All Plant Sequences

>Glyma17g10730.1   sequence type=CDS   gene model=Glyma17g10730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGATCTGGGGCCGGCAATTTCCTCAAGGTTCTTCTCAAAAACTTCGATGTCCTTGCTGGGCCTGTCATTAGTCTTGTTTATCCTCTATATGCTTCAATTAGGGCGATTGAGAGCAAGTCTCCCATTGATGATCAGCAGTGGCTCACTTACTGGGTTCTCTACTCCTTGATCACACTCTTTGAACTTACCTTTGCTAGAGTCCTTGAATGGATTCCAATATGGCCTTATGCAAAGCTGATTGCAACCTGCTGGTTGGTCCTTCCTTACTTTAGCGGTGCTGCTTATGTTTATGAGCATTATGTGAGACCTTTCTATGTCAATCCTCAGACCATTAACATCTGGTACGTTCCAAGGAAAAAAGACGCCTTGGGTAAGCGAGATGATATTCTAACTGCTGCAGAGAAGTACATCCAAGAGAATGGAACAGAAGCATTTGAGAATATCATCAATAGGGCTGACAAATCAAGAACGGGTGGCGGTTATTATTCAATGTATGATGAGACTTATTGA

Predicted protein sequences of Glyma17g10730

Limit To All Plant Sequences

>Glyma17g10730.1   sequence type=predicted peptide   gene model=Glyma17g10730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSGAGNFLKVLLKNFDVLAGPVISLVYPLYASIRAIESKSPIDDQQWLTYWVLYSLITLFELTFARVLEWIPIWPYAKLIATCWLVLPYFSGAAYVYEHYVRPFYVNPQTINIWYVPRKKDALGKRDDILTAAEKYIQENGTEAFENIINRADKSRTGGGYYSMYDETY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain