Report for Sequence Feature Glyma17g09940
Feature Type: gene_model
Chromosome: Gm17
Start: 7406484
stop: 7413534
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g09940
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G63800 AT
Annotation by Michelle Graham. TAIR10: ubiquitin-conjugating enzyme 5 | chr1:23667888-23669003 REVERSE LENGTH=185
SoyBase E_val: 1.00E-94 ISS
GO:0006511 GO-bp
Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005829 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosol
SoyBase N/A ISS
GO:0004842 GO-mf
Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity
SoyBase N/A ISS
GO:0016881 GO-mf
Annotation by Michelle Graham. GO Molecular Function: acid-amino acid ligase activity
SoyBase N/A ISS
KOG0416
KOG
Ubiquitin-protein ligase
JGI ISS
PTHR24067 Panther
UBIQUITIN-CONJUGATING ENZYME E2
JGI ISS
PTHR24067:SF19 Panther
JGI ISS
PF00179 PFAM
Ubiquitin-conjugating enzyme
JGI ISS
UniRef100_G7JNU0 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin carrier protein n=1 Tax=Medicago truncatula RepID=G7JNU0_MEDTR
SoyBase E_val: 6.00E-114 ISS
UniRef100_I1MTJ4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MTJ4_SOYBN
SoyBase E_val: 3.00E-131 ISS
Expression Patterns of Glyma17g09940
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma17g09940
Paralog Evidence Comments
Glyma05g01980 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g09940 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g091700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g09940
Coding sequences of Glyma17g09940
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g09940.1 sequence type=CDS gene model=Glyma17g09940 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTCATCTCCAAGCAAGAGAAGAGAAATGGATGTAATGAAACTGATGATGAGTGATTATGCAGTGGAGACTATAAATGATGGACTCAATGAGTTCAATGTGGAGTTTCATGGTCCAAAAGAAAGCCTTTATGAAGGTGGAGTCTGGAAAATTCGTGTTGAGCTTCCTGATGCTTACCCGTACAAATCCCCTTCTATTGGCTTTGTGAACAAAATATTCCACCCAAATGTTGATGAGCTATCTGGCTCTGTATGCTTGGATGTCATTAACCAATCTTGGAGTCCAATGTTTGATCTTCTAAATGTTTTTGAAGTTTTTCTTCCCCAACTCTTGCTTTATCCAAATGCTTCAGATCCTCTCAATGGTGATGCAGCATCGTTAATGATGAAGGATAAAAAGCTATATGACCAGAAAGTTAAAGAGTATTGTGAGCGGTATGCTAAGAAGGAAAACATTAGCAACTCTACAGCTGAAGAGAGTGGAGATGAGGAAGACATCAGTGAAGAAGAAAGTGGATCTAGTGATGATGAAATTCCTGGTCGCGCTGATCCTTAA
Predicted protein sequences of Glyma17g09940
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g09940.1 sequence type=predicted peptide gene model=Glyma17g09940 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSSPSKRREMDVMKLMMSDYAVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYPYKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNASDPLNGDAASLMMKDKKLYDQKVKEYCERYAKKENISNSTAEESGDEEDISEEESGSSDDEIPGRADP*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
