SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma17g09940

Feature Type:gene_model
Chromosome:Gm17
Start:7406484
stop:7413534
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G63800AT Annotation by Michelle Graham. TAIR10: ubiquitin-conjugating enzyme 5 | chr1:23667888-23669003 REVERSE LENGTH=185 SoyBaseE_val: 1.00E-94ISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0004842GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity SoyBaseN/AISS
GO:0016881GO-mf Annotation by Michelle Graham. GO Molecular Function: acid-amino acid ligase activity SoyBaseN/AISS
KOG0416 KOG Ubiquitin-protein ligase JGI ISS
PTHR24067Panther UBIQUITIN-CONJUGATING ENZYME E2 JGI ISS
PTHR24067:SF19Panther JGI ISS
PF00179PFAM Ubiquitin-conjugating enzyme JGI ISS
UniRef100_G7JNU0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin carrier protein n=1 Tax=Medicago truncatula RepID=G7JNU0_MEDTR SoyBaseE_val: 6.00E-114ISS
UniRef100_I1MTJ4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MTJ4_SOYBN SoyBaseE_val: 3.00E-131ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma05g01980 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g091700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g09940.1   sequence type=CDS   gene model=Glyma17g09940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCATCTCCAAGCAAGAGAAGAGAAATGGATGTAATGAAACTGATGATGAGTGATTATGCAGTGGAGACTATAAATGATGGACTCAATGAGTTCAATGTGGAGTTTCATGGTCCAAAAGAAAGCCTTTATGAAGGTGGAGTCTGGAAAATTCGTGTTGAGCTTCCTGATGCTTACCCGTACAAATCCCCTTCTATTGGCTTTGTGAACAAAATATTCCACCCAAATGTTGATGAGCTATCTGGCTCTGTATGCTTGGATGTCATTAACCAATCTTGGAGTCCAATGTTTGATCTTCTAAATGTTTTTGAAGTTTTTCTTCCCCAACTCTTGCTTTATCCAAATGCTTCAGATCCTCTCAATGGTGATGCAGCATCGTTAATGATGAAGGATAAAAAGCTATATGACCAGAAAGTTAAAGAGTATTGTGAGCGGTATGCTAAGAAGGAAAACATTAGCAACTCTACAGCTGAAGAGAGTGGAGATGAGGAAGACATCAGTGAAGAAGAAAGTGGATCTAGTGATGATGAAATTCCTGGTCGCGCTGATCCTTAA

>Glyma17g09940.1   sequence type=predicted peptide   gene model=Glyma17g09940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSPSKRREMDVMKLMMSDYAVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYPYKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNASDPLNGDAASLMMKDKKLYDQKVKEYCERYAKKENISNSTAEESGDEEDISEEESGSSDDEIPGRADP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo