SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma17g09810

Feature Type:gene_model
Chromosome:Gm17
Start:7317271
stop:7318756
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G20970AT Annotation by Michelle Graham. TAIR10: basic helix-loop-helix (bHLH) DNA-binding superfamily protein | chr4:11215259-11216212 FORWARD LENGTH=190 SoyBaseE_val: 2.00E-24ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF00010PFAM Helix-loop-helix DNA-binding domain JGI ISS
UniRef100_B9RB43UniRef Annotation by Michelle Graham. Most informative UniRef hit: DNA binding protein, putative n=1 Tax=Ricinus communis RepID=B9RB43_RICCO SoyBaseE_val: 3.00E-68ISS
UniRef100_C6TEG0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TEG0_SOYBN SoyBaseE_val: 7.00E-114ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma05g02110 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g090500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g09810.1   sequence type=CDS   gene model=Glyma17g09810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAAACACAAACACTAATACTAGTGGTTCACCAAAACTTGATCGCAAAACTATTGAAAGGAACCGCAGGATTCACATGAAATCTCTCTGCTTCAAGCTTGTTTCCACTATTCCTTCCAATTACCTCAAAACCTCCAAGGACATGCTTTCCCAGCAGGATCAGCTTCATCTAGCAGCCACGTACATAAAGCATCTGAGAGAAAGAATAGAGAAATTGAAGGGGGAGAAGGAGAAAGCCATGAACATGATGATGATGTCAAACCAAAGCAATAATAGGATTTTCAATACTGGCTCTGAGTTGCCTCTACTTGAAATAAAGGACTTGGGTTCGGGCATTGAAGTGATGTTGATAAGTGGGTTGAATAAGAACTTCATGCTCTATGAAGTAATTAGTGTCCTTGAGGAAGAGGGTGCTGAAGTTGTCGCTGCCAACTTCTCCACCGTTGCTGATAAGATCTTTTTACACGTTTCATGCTCAGGTTAA

>Glyma17g09810.1   sequence type=predicted peptide   gene model=Glyma17g09810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKNTNTNTSGSPKLDRKTIERNRRIHMKSLCFKLVSTIPSNYLKTSKDMLSQQDQLHLAATYIKHLRERIEKLKGEKEKAMNMMMMSNQSNNRIFNTGSELPLLEIKDLGSGIEVMLISGLNKNFMLYEVISVLEEEGAEVVAANFSTVADKIFLHVSCSG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo