SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g09801

Feature Type:gene_model
Chromosome:Gm17
Start:7305555
stop:7307649
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g09801
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G23650AT Annotation by Michelle Graham. TAIR10: calcium-dependent protein kinase 6 | chr4:12324967-12327415 REVERSE LENGTH=529 SoyBaseE_val: 3.00E-43ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0010119GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of stomatal movement SoyBaseN/AISS
GO:0010359GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of anion channel activity SoyBaseN/AISS
GO:0032880GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein localization SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0046777GO-bp Annotation by Michelle Graham. GO Biological Process: protein autophosphorylation SoyBaseN/AISS
GO:0051049GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transport SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004683GO-mf Annotation by Michelle Graham. GO Molecular Function: calmodulin-dependent protein kinase activity SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24349Panther SERINE/THREONINE-PROTEIN KINASE JGI ISS
PTHR24349:SF13Panther JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
UniRef100_B9RCK2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Calcium-dependent protein kinase, putative n=1 Tax=Ricinus communis RepID=B9RCK2_RICCO SoyBaseE_val: 2.00E-44ISS
UniRef100_UPI000233F1F7UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F1F7 related cluster n=1 Tax=unknown RepID=UPI000233F1F7 SoyBaseE_val: 2.00E-58ISS

Expression Patterns of Glyma17g09801
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g09801 not represented in the dataset
Glyma17g09801 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g09801 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g090400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g09801
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Transcripts of Glyma17g09801
>Glyma17g09801.2   sequence type=transcript   gene model=Glyma17g09801   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AATTACATTTAAATTATACTATTTTTAACAATTTTTTAACGAAGATAATGTTATCCTAAGACCATTTTGTAAAAATTATCTCAGAAGTAAGTGGGATTTTTAATGACGCGCAACATGTCTCTTCCTTTACTCTCTTGTGCTTAGGATTTCCAACGAACAGGGCCGTGACACTCTCTTGTGACCCACGACAACTTGGAGGATGTTCGGTGAGAGGTGAAAGATCATGCACCACCTCACCGGTCACCGCAACATCATGGAGCTCTGCGGCAGCGGTGAGCTTTTCGACCGGATCATCGCCAAGGGCCATTACCCCGAGCATGCCGCCGCCAACCTGTGCCGCCAGATTGTGACGGTGGTCCACGATTGCCACACCATGGGAGTGATGCACAGGGATCTCAAGCCAGAGAACTTCCTGTTCCTCAGCAAGGACGAGAACTCGCCGCTTAAGGACACATGCTTCGGTCTCTCCATTTTCTTCAAGCTCGGGAAGTTCCAAACTGAAATTGGCAAAGCCTGGACATCAAGAAGGAAGAATAATATATACCCAGTATTAAATTTTCTTCTTATTTTTTGTCTAAAGAATCAGCAGAAGATGAATGTTGTGAAGCAATTATATATTCTACAAGAGAGAATCGATAAGGAGGGTGCTGATTCTGCAGTACAGAAATCTTTACTAACGTCTTTAAAGGTCAATTCCCAAATGCGTCAAGCAACTAAATAAGTAGGAGACGTTTACGTTGGAATATAGTTGAAATTTATGTTTTAGAAATGTTACACACGTGTGTAACGCGCTTGTTCGTTGAATTTTATTTTTGCGGCAACAACCGGCATTGTTTGGCTGTTCCTTGGAGTACGTGTTGTGTGTTTCGAAAATATCTAGTACTAAAGTCTTATGTCATTTATTTACGCTTTATTTTGTTTTTTTTAATAGAAATTGAGAAGAGAGAAAAAATGAGATGACAGAAGTAGAAGAGAAAAAGAGTTTTTAAATCGTTTCATTGACGAGAG
Coding sequences of Glyma17g09801
>Glyma17g09801.1   sequence type=CDS   gene model=Glyma17g09801   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCACCACCTCACCGGTCACCGCAACATCATGGAGCTCTGCGGCAGCGGTGAGCTTTTCGACCGGATCATCGCCAAGGGCCATTACCCCGAGCATGCCGCCGCCAACCTGTGCCGCCAGATTGTGACGGTGGTCCACGATTGCCACACCATGGGAGTGATGCACAGGGATCTCAAGCCAGAGAACTTCCTGTTCCTCAGCAAGGACGAGAACTCGCCGCTTAAGGACACATGCTTCGGTCTCTCCATTTTCTTCAAGCTCGGGAAGTTCCAAACTGAAATTGGCAAAGCCTGGACATCAAGAAGGAAGAATAATATATACCCAGTATTAAATTTTCTTCTTATTTTTTGTCTAAAGAATCAGCAGAAGATGAATGTTGTGAAGCAATTATATATTCTACAAGAGAGAATCGATAAGGAGGGTGCTGATTCTGCAGTACAGAAATCTTTACTAACGTCTTTAAAGGTGAATTGTTTCTTTAAATACTCAAATTTTCAAACATGCAGTGTAGTGAAGGGAATTTTACTAATTTTTAATTAA

>Glyma17g09801.2   sequence type=CDS   gene model=Glyma17g09801   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCACCACCTCACCGGTCACCGCAACATCATGGAGCTCTGCGGCAGCGGTGAGCTTTTCGACCGGATCATCGCCAAGGGCCATTACCCCGAGCATGCCGCCGCCAACCTGTGCCGCCAGATTGTGACGGTGGTCCACGATTGCCACACCATGGGAGTGATGCACAGGGATCTCAAGCCAGAGAACTTCCTGTTCCTCAGCAAGGACGAGAACTCGCCGCTTAAGGACACATGCTTCGGTCTCTCCATTTTCTTCAAGCTCGGGAAGTTCCAAACTGAAATTGGCAAAGCCTGGACATCAAGAAGGAAGAATAATATATACCCAGTATTAAATTTTCTTCTTATTTTTTGTCTAAAGAATCAGCAGAAGATGAATGTTGTGAAGCAATTATATATTCTACAAGAGAGAATCGATAAGGAGGGTGCTGATTCTGCAGTACAGAAATCTTTACTAACGTCTTTAAAGGTCAATTCCCAAATGCGTCAAGCAACTAAATAA
Predicted protein sequences of Glyma17g09801
>Glyma17g09801.1   sequence type=predicted peptide   gene model=Glyma17g09801   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHHLTGHRNIMELCGSGELFDRIIAKGHYPEHAAANLCRQIVTVVHDCHTMGVMHRDLKPENFLFLSKDENSPLKDTCFGLSIFFKLGKFQTEIGKAWTSRRKNNIYPVLNFLLIFCLKNQQKMNVVKQLYILQERIDKEGADSAVQKSLLTSLKVNCFFKYSNFQTCSVVKGILLIFN*

>Glyma17g09801.2   sequence type=predicted peptide   gene model=Glyma17g09801   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHHLTGHRNIMELCGSGELFDRIIAKGHYPEHAAANLCRQIVTVVHDCHTMGVMHRDLKPENFLFLSKDENSPLKDTCFGLSIFFKLGKFQTEIGKAWTSRRKNNIYPVLNFLLIFCLKNQQKMNVVKQLYILQERIDKEGADSAVQKSLLTSLKVNSQMRQATK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo