SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G62790 | AT | Annotation by Michelle Graham. TAIR10: 1-deoxy-D-xylulose 5-phosphate reductoisomerase | chr5:25214358-25217292 REVERSE LENGTH=477 | SoyBase | E_val: 0 | ISS |
| GO:0000023 | GO-bp | Annotation by Michelle Graham. GO Biological Process: maltose metabolic process | SoyBase | N/A | ISS |
| GO:0000096 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sulfur amino acid metabolic process | SoyBase | N/A | ISS |
| GO:0006098 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt | SoyBase | N/A | ISS |
| GO:0006546 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glycine catabolic process | SoyBase | N/A | ISS |
| GO:0006636 | GO-bp | Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0006655 | GO-bp | Annotation by Michelle Graham. GO Biological Process: phosphatidylglycerol biosynthetic process | SoyBase | N/A | ISS |
| GO:0006733 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidoreduction coenzyme metabolic process | SoyBase | N/A | ISS |
| GO:0006766 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vitamin metabolic process | SoyBase | N/A | ISS |
| GO:0008299 | GO-bp | Annotation by Michelle Graham. GO Biological Process: isoprenoid biosynthetic process | SoyBase | N/A | ISS |
| GO:0008652 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0009072 | GO-bp | Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family metabolic process | SoyBase | N/A | ISS |
| GO:0009106 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lipoate metabolic process | SoyBase | N/A | ISS |
| GO:0009108 | GO-bp | Annotation by Michelle Graham. GO Biological Process: coenzyme biosynthetic process | SoyBase | N/A | ISS |
| GO:0009117 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nucleotide metabolic process | SoyBase | N/A | ISS |
| GO:0009416 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to light stimulus | SoyBase | N/A | ISS |
| GO:0009695 | GO-bp | Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0015994 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chlorophyll metabolic process | SoyBase | N/A | ISS |
| GO:0015995 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process | SoyBase | N/A | ISS |
| GO:0016117 | GO-bp | Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process | SoyBase | N/A | ISS |
| GO:0019216 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of lipid metabolic process | SoyBase | N/A | ISS |
| GO:0019252 | GO-bp | Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process | SoyBase | N/A | ISS |
| GO:0019288 | GO-bp | Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway | SoyBase | N/A | ISS |
| GO:0019748 | GO-bp | Annotation by Michelle Graham. GO Biological Process: secondary metabolic process | SoyBase | N/A | ISS |
| GO:0019760 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glucosinolate metabolic process | SoyBase | N/A | ISS |
| GO:0019761 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process | SoyBase | N/A | ISS |
| GO:0031408 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxylipin biosynthetic process | SoyBase | N/A | ISS |
| GO:0042744 | GO-bp | Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide catabolic process | SoyBase | N/A | ISS |
| GO:0043085 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity | SoyBase | N/A | ISS |
| GO:0044272 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sulfur compound biosynthetic process | SoyBase | N/A | ISS |
| GO:0046686 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cadmium ion | SoyBase | N/A | ISS |
| GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009570 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| GO:0030604 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: 1-deoxy-D-xylulose-5-phosphate reductoisomerase activity | SoyBase | N/A | ISS |
| GO:0046872 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: metal ion binding | SoyBase | N/A | ISS |
| GO:0070402 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: NADPH binding | SoyBase | N/A | ISS |
| PF02670 | PFAM | 1-deoxy-D-xylulose 5-phosphate reductoisomerase | JGI | ISS | |
| PF08436 | PFAM | 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal | JGI | ISS | |
| UniRef100_I1MTH5 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MTH5_SOYBN | SoyBase | E_val: 0 | ISS |
| UniRef100_Q0GYS3 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: 1-deoxy-D-xylulose 5-phosphate reductoisomerase n=1 Tax=Hevea brasiliensis RepID=Q0GYS3_HEVBR | SoyBase | E_val: 0 | ISS |
|
Glyma17g09740 not represented in the dataset |
Glyma17g09740 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma05g02190 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.17g089600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma17g09740.1 sequence type=CDS gene model=Glyma17g09740 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGATGGCTCTCAATATCTCTTCTCCTGCTGAAGTCAAGTCCATTTTTTTCGCTGATTACTTCAAGTCTAACTGCATCACTGCAAAGTTCACAGGTGGTTTTGCTTTTAAGAGAAAAGAGCGTGGAGCTGCATCTGGAGGGCGAGTTTGTTGCTCAGTGCTGGCACCACCACCACCGGCCTGGCCGGGACGAGCGGTTCCAGAGCAAGGCAGCAAGACTTGGGATGGACCAAAACCCATTTCAATTGTTGGGTGTACTGGTTCAATTGGAACTCAGACACTAGATATTGTGGCAGAGAATCCAGATAAGTTTAAAGTTGTGGCACTTGCAGCTGGTTCAAATGTTACTCTTCTTGCAGACCAGGTAAAAAGATTTAAGCCTCAACTTGTTGCTGTTAGAAATGAGTCCCTAATTGCTGAACTTAAAGAGGCCTTGCATGACGTTGAAGAAAAACCTGAGATCATCCCTGGAGAGCAGGGAATCATTGAGGTTGCTCGTCACCCAGATGCAGTCAGTGTAGTCACAGGAATAGTAGGCTGTGCAGGACTGAAGCCAACAGTTGCTGCGATAGAAGCAGGGAAATACATAGCTTTAGCCAACAAAGAGACATTGATTGCTGGAGGTCCTTTTGTTCTTCCTCTTGCTCAGAAGCATAATGTAAAAATACTTCCAGCTGATTCAGAACATTCTGCCATCTTTCAGTGTATCCAGGGGTTGCCAGAGGGTGCACTTAGGAGAGTTATTTTAACTGCATCTGGAGGTGCTTTCAGGGATTGGCCAGTTGATAAACTGAAAGATGTTAAAGTTGCTGATGCATTAAAACATCCTAACTGGAATATGGGGAAAAAGATAACTGTGGACTCTGCTACCCTTTTTAATAAGGGTCTAGAAGTAATTGAAGCACATTACTTGTTTGGAGCTGACTATGATCATATTGAGATTGTCATTCATCCACAATCAATCATACATTCAATGATTGAAACACAGGATTCATCTGTTCTTGCACAGTTGGGGTGGCCTGATATGCGTTTGCCAATCCTCTATACATTATCATGGCCTGACAGGATTTATTGTTCTGAAGACACTTGGCCCTGCCTTGATCTTTGCAAGATTGGTTCACTTACATTTAAAACTCCAGATAATGTAAAGTATCCATCCATGAATCTTGCCTATGCTGCTGGCCGTGCTGGAGGCACAATGACAGGAGTTCTTAGTGCAGCAAATGAGAAAGCTGTAGAGATGTTTATTGATGAAAAGATTAGCTATTTGGATATATTCAAAGTTGTGGAGCTAACATGTGAGAAGCATCAAAATGAATTGTTATCCTCTCCTTCCCTTGAGGAAATCATTCACTATGACCTGTGGGCGCGAGAATTTGCTGCTAGTTTGCAAGACTCTTCCAGCTTCACTCCTATTCTTGCATGA
>Glyma17g09740.1 sequence type=predicted peptide gene model=Glyma17g09740 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MMALNISSPAEVKSIFFADYFKSNCITAKFTGGFAFKRKERGAASGGRVCCSVLAPPPPAWPGRAVPEQGSKTWDGPKPISIVGCTGSIGTQTLDIVAENPDKFKVVALAAGSNVTLLADQVKRFKPQLVAVRNESLIAELKEALHDVEEKPEIIPGEQGIIEVARHPDAVSVVTGIVGCAGLKPTVAAIEAGKYIALANKETLIAGGPFVLPLAQKHNVKILPADSEHSAIFQCIQGLPEGALRRVILTASGGAFRDWPVDKLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGADYDHIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTLSWPDRIYCSEDTWPCLDLCKIGSLTFKTPDNVKYPSMNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKISYLDIFKVVELTCEKHQNELLSSPSLEEIIHYDLWAREFAASLQDSSSFTPILA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
