Report for Sequence Feature Glyma17g09731
Feature Type: gene_model
Chromosome: Gm17
Start: 7235060
stop: 7236615
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g09731
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G62770 AT
Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF1645) | chr5:25210564-25211370 FORWARD LENGTH=268
SoyBase E_val: 2.00E-13 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF07816 PFAM
Protein of unknown function (DUF1645)
JGI ISS
UniRef100_I1MTH4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MTH4_SOYBN
SoyBase E_val: 3.00E-60 ISS
Expression Patterns of Glyma17g09731
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma17g09731
Paralog Evidence Comments
Glyma05g02200 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g09731 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g089500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g09731
Coding sequences of Glyma17g09731
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g09731.1 sequence type=CDS gene model=Glyma17g09731 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGATGCAGACAGAGGCACCATCTTCTCCAAGTTTCAGCTTCCACAACAACTCTTCCGAGTCCTTCCCTCACGTCGACGATGACTTCGAGTTCTCCTTCGTTCCCAGACACACCGACTCCTCCCCCGTCTCCGCCGACGACATTTTCTACAACGGCCAGATCAGACCTATCTACCCTCTCTTCCACCAAAACGCAGTCGTTCACGCTTCCGCTACCACCGAAACGGCACCGCACGAGCCTCGCCGTCGTCGTTTACCTCTCAGGACGCTGATGTTCGAGGAGGAGGAGGAGCGAGAGACGGTGAAGATCGATAGCAGCAACGAGCTTTACGGCGTGGCTGAGGGAACCTACTGCGTGTGGACCCCACCGTGCAAGAAGGTAAGCAAGCGCTGGAAGATTCGAGATTTTCTGCTGCCTCGGAGTCACAGTGATGGCAAGAGGACCAGCAAGGTCGCGCCTAAGTATTCCTCCACCGCCGTAAACGGTGGCGCCTCCGCCAAACTGGTTGGCTTCTTCACTAATTAA
Predicted protein sequences of Glyma17g09731
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g09731.1 sequence type=predicted peptide gene model=Glyma17g09731 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MMQTEAPSSPSFSFHNNSSESFPHVDDDFEFSFVPRHTDSSPVSADDIFYNGQIRPIYPLFHQNAVVHASATTETAPHEPRRRRLPLRTLMFEEEEERETVKIDSSNELYGVAEGTYCVWTPPCKKVSKRWKIRDFLLPRSHSDGKRTSKVAPKYSSTAVNGGASAKLVGFFTN*