SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g09390

Feature Type:gene_model
Chromosome:Gm17
Start:6935855
stop:6937195
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g09390
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G01570AT Annotation by Michelle Graham. TAIR10: Oleosin family protein | chr3:222152-222778 REVERSE LENGTH=183 SoyBaseE_val: 1.00E-28ISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0019915GO-bp Annotation by Michelle Graham. GO Biological Process: lipid storage SoyBaseN/AISS
GO:0050826GO-bp Annotation by Michelle Graham. GO Biological Process: response to freezing SoyBaseN/AISS
GO:0012511GO-cc Annotation by Michelle Graham. GO Cellular Compartment: monolayer-surrounded lipid storage body SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF01277PFAM Oleosin JGI ISS
UniRef100_A5B9G2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Oleosin n=1 Tax=Vitis vinifera RepID=A5B9G2_VITVI SoyBaseE_val: 9.00E-33ISS
UniRef100_I1MTE2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MTE2_SOYBN SoyBaseE_val: 7.00E-111ISS

Expression Patterns of Glyma17g09390
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g09390 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g086400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g09390
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g09390
>Glyma17g09390.1   sequence type=CDS   gene model=Glyma17g09390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGACCCACAGCAACAAGACAACTACATGAAGCGAAAGCCTTCCAATTCCAATGTTCTCGTCCTCGCCGCCCTCGTGCCTTTCGGCGTCTCTCTTCTCATCCTCGTCGGCCTCACCCTCTCCGCCACCGTCATCAGCCTCACCGTCGTCACCCCACTCTTCGTCATTTTCAGCCCCGTCTTGCTCCCCGCGGCCCTATTCATCGCTCTCGCCGTCGCCGGCTTCCTCACATCCGGAGTCTTCGGCATCACCTCCATCTCTTCCTTTGCTTGGTTAGCCACCAATCTCCGCCGCTCACACTCACCGGAACACCCGCAACGTCCTCGGGACGACGCGGACCGCGTGGCCCAGAAAACCGATGAAGCCGTGCGTCAGGCCCAGGAAACAGTCCATCAGGCCCAAAAAGAGACCGCAACCAAGGCCCAGAAAGACATTAGTGAAACAAGAAAAGCCCACAAAGAAAGCGTAGCAACCTCGTGA
Predicted protein sequences of Glyma17g09390
>Glyma17g09390.1   sequence type=predicted peptide   gene model=Glyma17g09390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADPQQQDNYMKRKPSNSNVLVLAALVPFGVSLLILVGLTLSATVISLTVVTPLFVIFSPVLLPAALFIALAVAGFLTSGVFGITSISSFAWLATNLRRSHSPEHPQRPRDDADRVAQKTDEAVRQAQETVHQAQKETATKAQKDISETRKAHKESVATS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo