SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g09341

Feature Type:gene_model
Chromosome:Gm17
Start:6895990
stop:6896933
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g09341
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G14620AT Annotation by Michelle Graham. TAIR10: xyloglucan endotransglucosylase/hydrolase 10 | chr2:6244889-6246010 FORWARD LENGTH=299 SoyBaseE_val: 5.00E-18ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0006073GO-bp Annotation by Michelle Graham. GO Biological Process: cellular glucan metabolic process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0004553GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds SoyBaseN/AISS
GO:0016762GO-mf Annotation by Michelle Graham. GO Molecular Function: xyloglucan:xyloglucosyl transferase activity SoyBaseN/AISS
GO:0016798GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on glycosyl bonds SoyBaseN/AISS
UniRef100_B9S7W0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Xyloglucan endotransglucosylase/hydrolase protein A, putative n=1 Tax=Ricinus communis RepID=B9S7W0_RICCO SoyBaseE_val: 2.00E-16ISS
UniRef100_I1NG54UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NG54_SOYBN SoyBaseE_val: 2.00E-24ISS

Expression Patterns of Glyma17g09341
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g09341 not represented in the dataset
Glyma17g09341 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g09341 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g085900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g09341
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g09341
>Glyma17g09341.1   sequence type=CDS   gene model=Glyma17g09341   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTCACAAGTTAGAGCCCTCAGACATATATTCTTTCATAAGAACCATGAAAAACTTCCTCAAAGCACTACTTATCTTCTTCATTGGGTTTGTAATTTCCTCAAGTCTGTTTCAAGTTTCAGTTGCATCTGTTGTTTCAACAGGAGACTTCAATAAGAACTTCTTTGTGATATGGTCTCCCACCCATGTGAACTCCTCTGCTGAAGGACAAACAAGAAGCTTGAAATTGGACCAAGCATCTGATACTAACTATCTATAG
Predicted protein sequences of Glyma17g09341
>Glyma17g09341.1   sequence type=predicted peptide   gene model=Glyma17g09341   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSHKLEPSDIYSFIRTMKNFLKALLIFFIGFVISSSLFQVSVASVVSTGDFNKNFFVIWSPTHVNSSAEGQTRSLKLDQASDTNYL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo