SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g09165): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g09165): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g09165

Feature Type:gene_model
Chromosome:Gm17
Start:6780047
stop:6781453
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G01140AT Annotation by Michelle Graham. TAIR10: CBL-interacting protein kinase 9 | chr1:64398-67512 REVERSE LENGTH=447 SoyBaseE_val: 9.00E-41ISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0010555GO-bp Annotation by Michelle Graham. GO Biological Process: response to mannitol stimulus SoyBaseN/AISS
GO:0043266GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of potassium ion transport SoyBaseN/AISS
GO:0051365GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to potassium ion starvation SoyBaseN/AISS
GO:0055075GO-bp Annotation by Michelle Graham. GO Biological Process: potassium ion homeostasis SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
PTHR24343Panther SERINE/THREONINE KINASE JGI ISS
PTHR24343:SF133Panther JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
UniRef100_C4P7W1UniRef Annotation by Michelle Graham. Most informative UniRef hit: CBL-interacting protein kinase 12 n=1 Tax=Vitis vinifera RepID=C4P7W1_VITVI SoyBaseE_val: 2.00E-39ISS
UniRef100_UPI00023379C1UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023379C1 related cluster n=1 Tax=unknown RepID=UPI00023379C1 SoyBaseE_val: 7.00E-46ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g09165 not represented in the dataset

Glyma17g09165 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g084200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g09165.1   sequence type=CDS   gene model=Glyma17g09165   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCATTGGTGCTGCTACTTGTTTTCGGGTTCCACTCTCTCCACAAATTTTTTTCGACAACTTGATAGACAACAACAAACGAGCCAAGGTGTTGGCAAGCAAAACAAAAATTTACATTGTTCTAGAGTTTGTTGATGGGGGAGAACTATTTGACAGAATAGCTGCAAATGGGAGACTTAAAGAAGATGAAGCAAGAAGTTATTTCCAACAACTTATTAATCTTGTTGATTACTGCCATATTAGAGGTGTGTATCAGAGAGATTTGAAGCCTGAGAATCTTCTAGACTCAAATGGTGTCCTTAAAGTTTTACATTTTGGTTTGAGTACATACTCACAGAAAGTAAGATGA

>Glyma17g09165.1   sequence type=predicted peptide   gene model=Glyma17g09165   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIIGAATCFRVPLSPQIFFDNLIDNNKRAKVLASKTKIYIVLEFVDGGELFDRIAANGRLKEDEARSYFQQLINLVDYCHIRGVYQRDLKPENLLDSNGVLKVLHFGLSTYSQKVR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo