Glyma17g09100 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g09100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g09100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g09100

Feature Type:	gene_model
Chromosome:	Gm17
Start:	6744856
stop:	6746676
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g09100

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G08180	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein \| chr5:2631843-2633374 REVERSE LENGTH=156	SoyBase	E_val: 5.00E-69	ISS
GO:0001510	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA methylation	SoyBase	N/A	ISS
GO:0009165	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0009909	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of flower development	SoyBase	N/A	ISS
GO:0034968	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone lysine methylation	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
KOG3167	KOG	Box H/ACA snoRNP component, involved in ribosomal RNA pseudouridinylation	JGI		ISS
PTHR23105	Panther	60S RIBOSOMAL PROTEIN L10A - RELATED	JGI		ISS
PTHR23105:SF12	Panther	NUCLEOLAR PROTEIN FAMILY A MEMBER 2	JGI		ISS
PF01248	PFAM	Ribosomal protein L7Ae/L30e/S12e/Gadd45 family	JGI		ISS
UniRef100_B9RE76	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: H/ACA ribonucleoprotein complex subunit, putative n=1 Tax=Ricinus communis RepID=B9RE76_RICCO	SoyBase	E_val: 1.00E-79	ISS
UniRef100_C6SVF2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SVF2_SOYBN	SoyBase	E_val: 7.00E-94	ISS

Expression Patterns of Glyma17g09100

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g09100 not represented in the dataset	Glyma17g09100 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g09100 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g083500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g09100

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g09100

Limit To All Plant Sequences

>Glyma17g09100.2   sequence type=CDS   gene model=Glyma17g09100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGGCCCTGGCTCCCATTGCTAAACCTCTTGCTGGGAAGAAGCTTTGCAAGCGAACCCTAAAACTTGTTCGTAGAGCTGCCGAACACAAATGCTTGAAAAGAGGAGTGAAGGAGGTCGTTAAAAGTATAAGGAGAGGTCATAAAGGATTGTGTGTGATTGCTGGGAACATATCACCGATTGATGTCATCACTCATGTTCCTATTCTTTGTGAAGAGTCTGACATTCCTTATATTTATGTCCCATCTAAAGAAGATCTTGCAGGCGCAGGAGCAACAAAGAGGCCTACTTGCTGTGTTCTGGTACAGACAAAGCCTGCAAAGGGTGAAATAGAGCAAGGGGAACAAGAGAAACTAAAGTCAGATTATGATCAAGTTGTAGCGGAAGTTACTGAGCTTACAACTTCACTCTTTTGA

Predicted protein sequences of Glyma17g09100

Limit To All Plant Sequences

>Glyma17g09100.2   sequence type=predicted peptide   gene model=Glyma17g09100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLALAPIAKPLAGKKLCKRTLKLVRRAAEHKCLKRGVKEVVKSIRRGHKGLCVIAGNISPIDVITHVPILCEESDIPYIYVPSKEDLAGAGATKRPTCCVLVQTKPAKGEIEQGEQEKLKSDYDQVVAEVTELTTSLF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain