Report for Sequence Feature Glyma17g09050
Feature Type: gene_model
Chromosome: Gm17
Start: 6709918
stop: 6710843
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g09050
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_I1MTA5 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MTA5_SOYBN
SoyBase E_val: 1.00E-70 ISS
Expression Patterns of Glyma17g09050
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma17g09050
Paralog Evidence Comments
Glyma05g07570 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g09050 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g083000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g09050
Coding sequences of Glyma17g09050
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g09050.1 sequence type=CDS gene model=Glyma17g09050 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAGTAGTGACGCGATAGGTAACAATGGCGTGGGGAGGTTTGAGTGGAGCTGGAACTCCTCAGTTTCATTTCTGTACGGTGGACTTGCACCCATTTTTGGGGTCATTGTGGTAGCGTTGCTTTTGGTAGCACGTCAAGGGTGTCGTCCAAGATGGCCTGAAACAACAACAACAACAACAATAGAGTCACTGCGTGATGTTGACGTGAACAACTCGAGAGGGGTAGCAAATACTACACAAGTTGATGAAGGGCATAACATTTTGGTAATCGTAGCCGGAGAAGAGCACCCAACTCATTTGGCAAAGCCCCTCTCCTTGTGA
Predicted protein sequences of Glyma17g09050
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g09050.1 sequence type=predicted peptide gene model=Glyma17g09050 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSSDAIGNNGVGRFEWSWNSSVSFLYGGLAPIFGVIVVALLLVARQGCRPRWPETTTTTTIESLRDVDVNNSRGVANTTQVDEGHNILVIVAGEEHPTHLAKPLSL*