Glyma17g09010 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g09010

Feature Type:	gene_model
Chromosome:	Gm17
Start:	6687617
stop:	6687963
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g09010

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G60830	AT	Annotation by Michelle Graham. TAIR10: basic leucine-zipper 70 \| chr5:24472639-24473319 FORWARD LENGTH=206	SoyBase	E_val: 3.00E-11	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
GO:0046983	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity	SoyBase	N/A	ISS
UniRef100_B9RLH1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DNA binding protein, putative n=1 Tax=Ricinus communis RepID=B9RLH1_RICCO	SoyBase	E_val: 4.00E-14	ISS
UniRef100_I1MTA1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MTA1_SOYBN	SoyBase	E_val: 2.00E-68	ISS

Expression Patterns of Glyma17g09010

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g09010

Paralog	Evidence	Comments
Glyma05g07522	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g09010 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g082600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g09010

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g09010

Limit To All Plant Sequences

>Glyma17g09010.1   sequence type=CDS   gene model=Glyma17g09010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGCAAAGGCTCTCCTTGATGACAGAAAGAAGAGGATGTTCTCAAACAGAGAATCTGCTCGCAGTCCTGCAGTATCATGTGGATCATCTACAGACATTAAACCATCAACTGTCCCAAAAGATCATTTATTTGTTGGAATTTTACCAACAAATCCACCAACAGAATACTCAACTAAAAGAGAATGTTTCCTCTCTTCAGGTAGCACTCTCTGACTTGTTGGCTCCTTCTGGAAGTGCTGAGCAACCTCACCTCATCCCTAATGACTTCCTAGCCGAGCCTTTGACTCGACCAGTTGCAAGTTCCAGAACATAG

Predicted protein sequences of Glyma17g09010

Limit To All Plant Sequences

>Glyma17g09010.1   sequence type=predicted peptide   gene model=Glyma17g09010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKQRLSLMTERRGCSQTENLLAVLQYHVDHLQTLNHQLSQKIIYLLEFYQQIHQQNTQLKENVSSLQVALSDLLAPSGSAEQPHLIPNDFLAEPLTRPVASSRT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain