Glyma17g08961 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g08961

Feature Type:	gene_model
Chromosome:	Gm17
Start:	6628214
stop:	6630289
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g08961

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G69030	AT	Annotation by Michelle Graham. TAIR10: BSD domain-containing protein \| chr1:25947429-25949262 REVERSE LENGTH=317	SoyBase	E_val: 2.00E-39	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
PF03909	PFAM	BSD domain	JGI		ISS
UniRef100_B4FWY5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: BSD domain containing protein n=1 Tax=Zea mays RepID=B4FWY5_MAIZE	SoyBase	E_val: 3.00E-43	ISS
UniRef100_I1MT96	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MT96_SOYBN	SoyBase	E_val: 2.00E-84	ISS

Expression Patterns of Glyma17g08961

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g08961 not represented in the dataset	Glyma17g08961 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g08961

Paralog	Evidence	Comments
Glyma05g07470	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g08961 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g081900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g08961

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g08961

Limit To All Plant Sequences

>Glyma17g08961.1   sequence type=CDS   gene model=Glyma17g08961   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGCTGTGGAACAGAGCCCGAGGCTTTGCGGAAGAAGCAGCGAAACGATCACAGTACTTGCCCCAACCTTCTATCATAAACGGCGTCTATCTCCACCGTTTTGGCATCACCCAAGAGTTGAGGGAGTTCGTCGAAGGAATTACCATCACTACCTTTGAGGATTTTCCCCTTCAAGATGATACGGAATTGTCTGATGTTCCTGCAGTTTCAAATGTTAGGCAGGATCTAACCGAGTGGCAGGAAAAACATGCCAGGCTTGTTCTTTCTACAGTCAAGGAGATTTCAAGATTGAGGTATGAACCGTGTCCACAAGTCATGAAAGAGAGGAAGTTTTGGAGAATATACTTTATACTTGTGAATAATCACATTGCACCGTAA

Predicted protein sequences of Glyma17g08961

Limit To All Plant Sequences

>Glyma17g08961.1   sequence type=predicted peptide   gene model=Glyma17g08961   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MELWNRARGFAEEAAKRSQYLPQPSIINGVYLHRFGITQELREFVEGITITTFEDFPLQDDTELSDVPAVSNVRQDLTEWQEKHARLVLSTVKEISRLRYEPCPQVMKERKFWRIYFILVNNHIAP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain