Glyma17g08921 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g08921

Feature Type:	gene_model
Chromosome:	Gm17
Start:	6599070
stop:	6599921
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g08921

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G60880	AT	Annotation by Michelle Graham. TAIR10: breaking of asymmetry in the stomatal lineage \| chr5:24488553-24489703 REVERSE LENGTH=262	SoyBase	E_val: 1.00E-16	ISS
GO:0009786	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of asymmetric cell division	SoyBase	N/A	ISS
GO:0009826	GO-bp	Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth	SoyBase	N/A	ISS
GO:0010374	GO-bp	Annotation by Michelle Graham. GO Biological Process: stomatal complex development	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0019897	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extrinsic to plasma membrane	SoyBase	N/A	ISS
UniRef100_B9RLI7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RLI7_RICCO	SoyBase	E_val: 5.00E-20	ISS
UniRef100_Q5BPF3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Breaking of asymmetry in the stomatal lineage protein n=1 Tax=Arabidopsis thaliana RepID=Q5BPF3_ARATH	SoyBase	E_val: 6.00E-14	ISS

Expression Patterns of Glyma17g08921

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g08921 not represented in the dataset	Glyma17g08921 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g08921

Paralog	Evidence	Comments
Glyma05g07431	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g08921 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g081600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g08921

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g08921

Limit To All Plant Sequences

>Glyma17g08921.1   sequence type=CDS   gene model=Glyma17g08921   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAAGCTTGGCATTTGATAAGAAAAACGAAAAAAGTTTTAATAGTATTAGTAACAACGATTTGTCACGGCCAAGCAAAAAAATCCACAGCAAGGAGAGACTTTCAAACAATCCAATAATAAAGGATAAAGATGATGGTGGGGTTCCCATTGGAAACAAGTTTGATTGTTCAAGTTGGTCACTCTCCGCGGATGAAGATTACATAGTGTTTTGCTTTGGAAAGGATGTGGCACAAGGTGACAAAAGTGTTAATGAAGTGCATAAAAATTCAAGGCCAGTGAATCGCAAGCTGAAATATGGTGAGAATGAAGAACAAGTTAGAGACCTGAACATTCATGAGAAAATATCAAATGCTAATCAGCACCACAATGATGATGACATGAGAAGGGCAGAATCAAGTAACTCTGACCAATCTGAAGGCAGTAGAAGTTCTTTTGCATTCCCTGTGTTAGGTTGGGAATGGATTGGAAGCCCTGTACAAATGCCCAAGTCAGAAGGTTTGCACCTAAGGAAGAACAAGGCTCGAGCTATGCGATTTGAGTGTTGTAGATTCTGA

Predicted protein sequences of Glyma17g08921

Limit To All Plant Sequences

>Glyma17g08921.1   sequence type=predicted peptide   gene model=Glyma17g08921   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKSLAFDKKNEKSFNSISNNDLSRPSKKIHSKERLSNNPIIKDKDDGGVPIGNKFDCSSWSLSADEDYIVFCFGKDVAQGDKSVNEVHKNSRPVNRKLKYGENEEQVRDLNIHEKISNANQHHNDDDMRRAESSNSDQSEGSRSSFAFPVLGWEWIGSPVQMPKSEGLHLRKNKARAMRFECCRF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain