SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma17g08890

Feature Type:gene_model
Chromosome:Gm17
Start:6576987
stop:6586049
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G60910AT Annotation by Michelle Graham. TAIR10: AGAMOUS-like 8 | chr5:24502736-24506013 REVERSE LENGTH=242 SoyBaseE_val: 5.00E-104ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009911GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of flower development SoyBaseN/AISS
GO:0010077GO-bp Annotation by Michelle Graham. GO Biological Process: maintenance of inflorescence meristem identity SoyBaseN/AISS
GO:0010154GO-bp Annotation by Michelle Graham. GO Biological Process: fruit development SoyBaseN/AISS
GO:0031540GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of anthocyanin biosynthetic process SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
KOG0014 KOG MADS box transcription factor JGI ISS
PTHR11945Panther MADS BOX PROTEIN JGI ISS
PTHR11945:SF19Panther MADS BOX PROTEIN JGI ISS
PF00319PFAM SRF-type transcription factor (DNA-binding and dimerisation domain) JGI ISS
PF01486PFAM K-box region JGI ISS
UniRef100_I1MT91UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MT91_SOYBN SoyBaseE_val: 3.00E-174ISS
UniRef100_I1U3J9UniRef Annotation by Michelle Graham. Most informative UniRef hit: MADS-box protein n=1 Tax=Pisum sativum RepID=I1U3J9_PEA SoyBaseE_val: 1.00E-114ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma05g07380 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g081200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g08890.1   sequence type=CDS   gene model=Glyma17g08890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGAGGGGAAGAGTGGATTTGAAGAGGATCGAGAACAAGATCAATAGGCAAGTGACTTTCTCCAAGAGAAGGTCTGGCTTGCTTAAGAAAGCGCGCGAGATTTCTGTGCTGTGCGATGCTGATGTGGCTCTCATCGTCTTCTCCACTAAAGGCAAGCTTTTCGACTACTCCAACGAACCTTGTATGAAAAGAATTCTTGAACGGTATGAGAGGTATTCGTATGCGGAGAGACAACTTGCTGGAGATGATCAAGCACCAAATGAAAACTGGGTTATAGAACACGAAAAGCTCAAGGCTAGGGTGGAGGTACTACAGCGAAATCAAAGGAATTTTATGGGAGAAGATCTGGACAGCTTAAATCTTAGAGGACTTCAGAGTTTGGAACAACAACTTGATTCTGCTCTCAAACTCATTAGATCACGAAAGAACCAAGCCATGAATGAATCTATTTCTGCGCTTCAGAAAAAGGATAAGTCACTCCGGGAACACAACAACTTGCTCTCCAAGAAGATAAAGGATAAAGAGAAGGAGCTGGCCCCACAAGAGCAAGATGGACTGCAAAATAACATGGATGTGACCTCTGTCCTTGTAACTCAACCACCGGAGTCCCTGACAATTGGAGGCTTCCCAGAAGCCAAATGTAATGAAGAAACTCCAACGTCGAGTCGACCTAAAACCATTCTTCCCCCTTGGATGCCTCTTCCTACAAATGAATAG

>Glyma17g08890.1   sequence type=predicted peptide   gene model=Glyma17g08890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRGRVDLKRIENKINRQVTFSKRRSGLLKKAREISVLCDADVALIVFSTKGKLFDYSNEPCMKRILERYERYSYAERQLAGDDQAPNENWVIEHEKLKARVEVLQRNQRNFMGEDLDSLNLRGLQSLEQQLDSALKLIRSRKNQAMNESISALQKKDKSLREHNNLLSKKIKDKEKELAPQEQDGLQNNMDVTSVLVTQPPESLTIGGFPEAKCNEETPTSSRPKTILPPWMPLPTNE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo