SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g08861): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g08861): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g08861

Feature Type:gene_model
Chromosome:Gm17
Start:6559991
stop:6565769
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G03710AT Annotation by Michelle Graham. TAIR10: K-box region and MADS-box transcription factor family protein | chr2:1129622-1131628 FORWARD LENGTH=257 SoyBaseE_val: 9.00E-88ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0010048GO-bp Annotation by Michelle Graham. GO Biological Process: vernalization response SoyBaseN/AISS
GO:0010076GO-bp Annotation by Michelle Graham. GO Biological Process: maintenance of floral meristem identity SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0048440GO-bp Annotation by Michelle Graham. GO Biological Process: carpel development SoyBaseN/AISS
GO:0048441GO-bp Annotation by Michelle Graham. GO Biological Process: petal development SoyBaseN/AISS
GO:0048442GO-bp Annotation by Michelle Graham. GO Biological Process: sepal development SoyBaseN/AISS
GO:0048443GO-bp Annotation by Michelle Graham. GO Biological Process: stamen development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
KOG0014 KOG MADS box transcription factor JGI ISS
PTHR11945Panther MADS BOX PROTEIN JGI ISS
PTHR11945:SF19Panther MADS BOX PROTEIN JGI ISS
PF00319PFAM SRF-type transcription factor (DNA-binding and dimerisation domain) JGI ISS
PF01486PFAM K-box region JGI ISS
UniRef100_G9I2S0UniRef Annotation by Michelle Graham. Most informative UniRef hit: SEP1 n=1 Tax=Acca sellowiana RepID=G9I2S0_9MYRT SoyBaseE_val: 2.00E-111ISS
UniRef100_UPI000233F07EUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F07E related cluster n=1 Tax=unknown RepID=UPI000233F07E SoyBaseE_val: 7.00E-179ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g08861 not represented in the dataset

Glyma17g08861 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma05g07286 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g080900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g08861.1   sequence type=CDS   gene model=Glyma17g08861   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAAGAGGGAGAGTTGAACTGAAGAGGATAGAGAACAAAATTAACAGGCAAGTCACATTTGCCAAAAGGAGAAATGGGTTGCTCAAGAAGGCTTATGAGCTCTCAGTACTTTGCGATGCTGAGGTTGCCCTCATCATCTTCTCCAACCGTGGCAAGCTTTATGAGTTCAGCAGCACCTCAAGTATGATGAAAACACTGGAGAAGTACCAGAAGTACAGCTACAGTGCACTGGAGACCACCCGTCCAATTAATGACTCTCAGAACTATCAGGAATATTTGAGATTAAAAGCAAGGGTAGAAGTTTTGCAATGTTCTCAAAGGAACCTACTTGGGGAAGATCTTGCCCAAATGAATACAAATGAGCTAGAGCAGCTTGAGAATCAACTGGAGACAGCACTGAAGAATATTAGGTCAACAAAGACTCAATTCATGCTTGACCAACTTTCTGATCTTCATCACCGGGAAACATTGCTTATTGAAACCAATAATGTGTTAAGGAGTAAGTTGGAAGAAACTAATAATTCACAAGTTCAAGTAAGTCTAGCTTTGGAAGCTGGAGGGCCTAGCATCCAATACACCAACTTTCCACCTCAATCAGAGGGGTTCTTCCAGCCAATGGGAGTGAATCCCACCTTGCAAATTGGGTACAACCAGACTAATCCACATGATGCAAACGTTGGAGCTTCATCCTTAAGTATGCATGGATTCGCCTCTGAGTGGATGCTTTGA

>Glyma17g08861.1   sequence type=predicted peptide   gene model=Glyma17g08861   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSSTSSMMKTLEKYQKYSYSALETTRPINDSQNYQEYLRLKARVEVLQCSQRNLLGEDLAQMNTNELEQLENQLETALKNIRSTKTQFMLDQLSDLHHRETLLIETNNVLRSKLEETNNSQVQVSLALEAGGPSIQYTNFPPQSEGFFQPMGVNPTLQIGYNQTNPHDANVGASSLSMHGFASEWML*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo