SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g08790

Feature Type:gene_model
Chromosome:Gm17
Start:6480904
stop:6482059
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g08790
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G11175AT Annotation by Michelle Graham. TAIR10: Nucleic acid-binding, OB-fold-like protein | chr4:6818162-6818806 FORWARD LENGTH=141 SoyBaseE_val: 4.00E-31ISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0006413GO-bp Annotation by Michelle Graham. GO Biological Process: translational initiation SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0003743GO-mf Annotation by Michelle Graham. GO Molecular Function: translation initiation factor activity SoyBaseN/AISS
PF01176PFAM Translation initiation factor 1A / IF-1 JGI ISS
UniRef100_Q94KR7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Translation initiation factor IF-1, chloroplastic n=1 Tax=Glycine max RepID=IF1C_SOYBN SoyBaseE_val: 6.00E-96ISS
UniRef100_Q94KR7UniRef Annotation by Michelle Graham. Best UniRef hit: Translation initiation factor IF-1, chloroplastic n=1 Tax=Glycine max RepID=IF1C_SOYBN SoyBaseE_val: 6.00E-96ISS

Expression Patterns of Glyma17g08790
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g08790
ParalogEvidenceComments
Glyma05g00260 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g08790 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g080200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g08790
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g08790
>Glyma17g08790.1   sequence type=CDS   gene model=Glyma17g08790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCACCTCACTCCACACCCCAATCCTTCACCCCCGTTACTGTCACCACCCTACACCGTCCTGCACCCAATTCTCCCCTCTCGCCCTCCCACCCTTCCACCGCACCCTCTCCTTCCTCGCCCCTCCGCCGCTCCTCCCGGCCGCGCCCGCCCTCTCCGCCGCCTCCGCCGCGAAGCCCGACAAGTCCGGCGAGCAGAAGTGGGTGCACGAGGGTCTCATCATGGAGTCTCTCCCGAACGGCATGTTCCGCGTTCGCCTGGATAACGAGGACTTGATCCTCGGCTACATCTCCGGCAAAATCCGCAAGAACTACGTTCGGATCCTCCCCGGCGACAGAGTCAAGGTCGAGGTCACCCGCTACGACTCCTCCAAAGGACGCATCGTTTATAGGCTCCGCAGCAGCACCCCCTCCTAG
Predicted protein sequences of Glyma17g08790
>Glyma17g08790.1   sequence type=predicted peptide   gene model=Glyma17g08790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFTSLHTPILHPRYCHHPTPSCTQFSPLALPPFHRTLSFLAPPPLLPAAPALSAASAAKPDKSGEQKWVHEGLIMESLPNGMFRVRLDNEDLILGYISGKIRKNYVRILPGDRVKVEVTRYDSSKGRIVYRLRSSTPS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo