|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G04400 | AT | Annotation by Michelle Graham. TAIR10: Ribosomal protein L14p/L23e family protein | chr3:1167611-1168308 FORWARD LENGTH=125 | SoyBase | E_val: 6.00E-12 | ISS |
| GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS |
| GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
| GO:0005840 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: ribosome | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0022625 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit | SoyBase | N/A | ISS |
| GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS |
| UniRef100_G7KXE3 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L23 n=3 Tax=Medicago truncatula RepID=G7KXE3_MEDTR | SoyBase | E_val: 1.00E-09 | ISS |
| UniRef100_UPI000233E52F | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233E52F related cluster n=1 Tax=unknown RepID=UPI000233E52F | SoyBase | E_val: 7.00E-14 | ISS |
|
Glyma17g08750 not represented in the dataset |
Glyma17g08750 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma17g08750.1 sequence type=CDS gene model=Glyma17g08750 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTTCATGGACACCGTCAAGAAGGGAAAGCCTGATCTCCGTAAGCGCAAGCCATGGCACCCAAAAGACGGCGTTTACATGTACTTTGAAGATAATGTTGGATCATAG
>Glyma17g08750.1 sequence type=predicted peptide gene model=Glyma17g08750 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MFMDTVKKGKPDLRKRKPWHPKDGVYMYFEDNVGS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||