SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g08750

Feature Type:gene_model
Chromosome:Gm17
Start:6440342
stop:6440476
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g08750
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G04400AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L14p/L23e family protein | chr3:1167611-1168308 FORWARD LENGTH=125 SoyBaseE_val: 6.00E-12ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
UniRef100_G7KXE3UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L23 n=3 Tax=Medicago truncatula RepID=G7KXE3_MEDTR SoyBaseE_val: 1.00E-09ISS
UniRef100_UPI000233E52FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E52F related cluster n=1 Tax=unknown RepID=UPI000233E52F SoyBaseE_val: 7.00E-14ISS

Expression Patterns of Glyma17g08750
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g08750 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma17g08750
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g08750
>Glyma17g08750.1   sequence type=CDS   gene model=Glyma17g08750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCATGGACACCGTCAAGAAGGGAAAGCCTGATCTCCGTAAGCGCAAGCCATGGCACCCAAAAGACGGCGTTTACATGTACTTTGAAGATAATGTTGGATCATAG
Predicted protein sequences of Glyma17g08750
>Glyma17g08750.1   sequence type=predicted peptide   gene model=Glyma17g08750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFMDTVKKGKPDLRKRKPWHPKDGVYMYFEDNVGS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo