Report for Sequence Feature Glyma17g08701
Feature Type: gene_model
Chromosome: Gm17
Start: 6414756
stop: 6416593
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g08701
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G08040 AT
Annotation by Michelle Graham. TAIR10: mitochondrial import receptor subunit TOM5 homolog | chr5:2577358-2578073 REVERSE LENGTH=54
SoyBase E_val: 2.00E-17 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0009536 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plastid
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1MT74 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MT74_SOYBN
SoyBase E_val: 5.00E-30 ISS
UniRef100_Q9SD80 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial import receptor subunit TOM5 homolog n=2 Tax=Arabidopsis thaliana RepID=TOM5_ARATH
SoyBase E_val: 1.00E-14 ISS
Expression Patterns of Glyma17g08701
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma17g08701
Paralog Evidence Comments
Glyma05g00341 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g08701 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g079100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g08701
Coding sequences of Glyma17g08701
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g08701.1 sequence type=CDS gene model=Glyma17g08701 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCCGACTCTGTAATTTCGATTCAGTACCTTAAAGATTTCGTCAATTCTCAAATCTACGACGATGAGAAGTGGGCCTTCAATGCGAAATTGCTGCGTGCTGCTGGATTGTTTGCAGGATCAATATTACTTATGCGAAACTATGGTGACCTTATGGCAATTTGA
Predicted protein sequences of Glyma17g08701
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g08701.1 sequence type=predicted peptide gene model=Glyma17g08701 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MADSVISIQYLKDFVNSQIYDDEKWAFNAKLLRAAGLFAGSILLMRNYGDLMAI*