Glyma17g08630 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g08630

Feature Type:	gene_model
Chromosome:	Gm17
Start:	6382482
stop:	6385684
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g08630

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G61030	AT	Annotation by Michelle Graham. TAIR10: glycine-rich RNA-binding protein 3 \| chr5:24560870-24562152 FORWARD LENGTH=309	SoyBase	E_val: 3.00E-54	ISS
GO:0006626	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion	SoyBase	N/A	ISS
GO:0009220	GO-bp	Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009909	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of flower development	SoyBase	N/A	ISS
GO:0010228	GO-bp	Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem	SoyBase	N/A	ISS
GO:0034968	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone lysine methylation	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
KOG0107	KOG	Alternative splicing factor SRp20/9G8 (RRM superfamily)	JGI		ISS
PTHR24012	Panther	FAMILY NOT NAMED	JGI		ISS
PF00076	PFAM	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	JGI		ISS
UniRef100_C6TJN7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TJN7_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_G7IZB0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 28 kDa ribonucleoprotein n=1 Tax=Medicago truncatula RepID=G7IZB0_MEDTR	SoyBase	E_val: 7.00E-60	ISS

Expression Patterns of Glyma17g08630

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g08630

Paralog	Evidence	Comments
Glyma05g00400	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g08630 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g078400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g08630

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g08630

Limit To All Plant Sequences

>Glyma17g08630.1   sequence type=CDS   gene model=Glyma17g08630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTTCTTTGGTAGAATTGGGAATTTGTTACGACAGACAGCGAGCAGGCAGGTTAGTTCAAAATTGCGTTCGCCCCCTTCATTTTTTCAGGCTATACGCTGTATGTCATCTGCCCCAAGCACAAAACTGTTTATTGGAGGTGTTTCATATTCTACTGACGAGCAAAGCTTGAGGGAAGCTTTTTCAAAATATGGTGAAGTTGTTGATGCTCGGATAATTATGGATCGTGAAACTGGTAGATCCAGAGGATTTGGCTTTATTACATACACTTCGGTTGAGGAGGCATCAAGTGCCATTCAGGCCTTGGATGGTCAGGATCTTCATGGTCGCCCAATTAGGGTGAATTATGCTAATGAAAGACCTCGTGGATATGGTGGTGGTGGCGGCGGCTTTGGTTCATATGGTGCTGTAGGTGGCGGTGGTTATGAAGGTGGTGGTGGCAGCGGTTATCGTGGAAATGTTTCTGATGGTTATGGTGGTGGCAACTATAGTCGAAATGATGGGGGTGGTTATGGATATGGTGCAGGCAGTTATGGATCAGGCGGCAATTATGGGGACAGTGGCCCTGGCAATAACTACTCGGGAGGCTATAGTGGTAGTAACAGTGGACATTTTGGTGATGCCGGTAGTGTAGGCAATCATGAAAGCTCTACTGGTTTTGCCGGTAATGGATATGATGGAAGTGTCGTGGATGGCGGTGTTGGTGCAGGGTCGGAATTTGGCAGCAGTGGCCAATTAGATAGCAAAACAAGCAGCAATGGAGATGAGGGTTTTGGGGATTACAGGGATGACAACGATGCAGATAATTTTGCCAAGAGGGCTTGA

Predicted protein sequences of Glyma17g08630

Limit To All Plant Sequences

>Glyma17g08630.1   sequence type=predicted peptide   gene model=Glyma17g08630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAFFGRIGNLLRQTASRQVSSKLRSPPSFFQAIRCMSSAPSTKLFIGGVSYSTDEQSLREAFSKYGEVVDARIIMDRETGRSRGFGFITYTSVEEASSAIQALDGQDLHGRPIRVNYANERPRGYGGGGGGFGSYGAVGGGGYEGGGGSGYRGNVSDGYGGGNYSRNDGGGYGYGAGSYGSGGNYGDSGPGNNYSGGYSGSNSGHFGDAGSVGNHESSTGFAGNGYDGSVVDGGVGAGSEFGSSGQLDSKTSSNGDEGFGDYRDDNDADNFAKRA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain