Report for Sequence Feature Glyma17g08570
Feature Type: gene_model
Chromosome: Gm17
Start: 6344613
stop: 6349022
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g08570
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G18650 AT
Annotation by Michelle Graham. TAIR10: plasmodesmata callose-binding protein 3 | chr1:6419036-6420413 REVERSE LENGTH=184
SoyBase E_val: 3.00E-50 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0009506 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma
SoyBase N/A ISS
GO:0031225 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane
SoyBase N/A ISS
GO:0001872 GO-mf
Annotation by Michelle Graham. GO Molecular Function: (1->3)-beta-D-glucan binding
SoyBase N/A ISS
GO:0030247 GO-mf
Annotation by Michelle Graham. GO Molecular Function: polysaccharide binding
SoyBase N/A ISS
PTHR16631 Panther
GLUCAN 1,3-BETA-GLUCOSIDASE-RELATED
JGI ISS
PTHR16631:SF1 Panther
GLUCAN 1,3-BETA-GLUCOSIDASE
JGI ISS
PF07983 PFAM
X8 domain
JGI ISS
UniRef100_B9RLP4 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Hydrolase, hydrolyzing O-glycosyl compounds, putative n=1 Tax=Ricinus communis RepID=B9RLP4_RICCO
SoyBase E_val: 2.00E-56 ISS
UniRef100_C6TNI5 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TNI5_SOYBN
SoyBase E_val: 1.00E-140 ISS
Expression Patterns of Glyma17g08570
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma17g08570
Paralog Evidence Comments
Glyma05g00470 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g08570 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g077900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g08570
Coding sequences of Glyma17g08570
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g08570.1 sequence type=CDS gene model=Glyma17g08570 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTGCTCTAGCTCTAGCACTGCTTCTTCTGGCTTTCACTGGCACTTCAAGTGCTACATGGTGCGTTTGCAAGGATGGAAGCGACGCGATCCTGCAGAAAACCTTGGACTATGCTTGTGGAGCTGGTGCTGACTGTAATCCTCTCCACCAAAACGGGCCTTGTTTCCAGCCCAACACCGTTAGGGCCCACTGTAACTACGCCGTGAACAGCTACTTCCAAAGGAAGGGTCAAGCTCAAGGGTCCTGCGACTTTGCGGGAACAGCCATTGTTACTGCATCTGACCCCAGCTCTGGCGGTACTTGTGTCTACCCTTCTAGTGTCAGCGCTGCAGGCACTGGTACAACTCCAGTGACTACCACACCAACCATGGGCACCACTCCTACAACTGGAACTCCATCAACAAGCACCGGCACGGGCACCGGCACCGGCACAGGCACCACTCCATACAGCACAACACCTGGAGTATTAGGAGGCATTGGCAGTGGCATGGGACCTTCAGGATCCGGCATGAATGACGAAAGTCACGGTGGCATTGGACTTGTACACAGCAGTAGTTTCTTCTCGATGGCGCTCTTCTCTGCCTTCATGATGATGCTCTGCTGGGGTTGA
Predicted protein sequences of Glyma17g08570
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g08570.1 sequence type=predicted peptide gene model=Glyma17g08570 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAALALALLLLAFTGTSSATWCVCKDGSDAILQKTLDYACGAGADCNPLHQNGPCFQPNTVRAHCNYAVNSYFQRKGQAQGSCDFAGTAIVTASDPSSGGTCVYPSSVSAAGTGTTPVTTTPTMGTTPTTGTPSTSTGTGTGTGTGTTPYSTTPGVLGGIGSGMGPSGSGMNDESHGGIGLVHSSSFFSMALFSAFMMMLCWG*