SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g08491

Feature Type:gene_model
Chromosome:Gm17
Start:6288700
stop:6291419
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g08491
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G29360AT Annotation by Michelle Graham. TAIR10: UDP-glucose 6-dehydrogenase family protein | chr3:11267375-11268817 REVERSE LENGTH=480 SoyBaseE_val: 0ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0006007GO-bp Annotation by Michelle Graham. GO Biological Process: glucose catabolic process SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0007033GO-bp Annotation by Michelle Graham. GO Biological Process: vacuole organization SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0052546GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall pectin metabolic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003979GO-mf Annotation by Michelle Graham. GO Molecular Function: UDP-glucose 6-dehydrogenase activity SoyBaseN/AISS
GO:0016616GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor SoyBaseN/AISS
GO:0051287GO-mf Annotation by Michelle Graham. GO Molecular Function: NAD binding SoyBaseN/AISS
KOG2666 KOG UDP-glucose/GDP-mannose dehydrogenase JGI ISS
PTHR11374Panther UDP-GLUCOSE DEHYDROGENASE/UDP-MANNAC DEHYDROGENASE JGI ISS
PF00984PFAM UDP-glucose/GDP-mannose dehydrogenase family, central domain JGI ISS
PF03720PFAM UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain JGI ISS
PF03721PFAM UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain JGI ISS
UniRef100_I1JZK3UniRef Annotation by Michelle Graham. Best UniRef hit: UDP-glucose 6-dehydrogenase n=1 Tax=Glycine max RepID=I1JZK3_SOYBN SoyBaseE_val: 0ISS
UniRef100_I1JZK3UniRef Annotation by Michelle Graham. Most informative UniRef hit: UDP-glucose 6-dehydrogenase n=1 Tax=Glycine max RepID=I1JZK3_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma17g08491
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g08491 not represented in the dataset
Glyma17g08491 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g08491
ParalogEvidenceComments
Glyma05g00590 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g08491 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g077000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g08491
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g08491
>Glyma17g08491.1   sequence type=CDS   gene model=Glyma17g08491   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGAAGATATGTGGAATTGGAGCCGGGTACGTAGGGGGTCCAACAATGGCTGTGATTGCCCTCAAATGCCCCTCAATTGAAGTGGCTGTGGTTGACATCTCTCACTCTCGCATATCAGCTTGGAACAGCAACAAACTCCCCATTTACGAGCCCGGCCTAGAACAAGTGGTGAATCAGTGCAGAGGAAAGAACCTCCTCTTCAGCACCGATGTGGAAAAGCATGTGCATGAGGCAGACATAGTCTTTCTCTCAGTGAACACCCCAACAAAAACCAGAGGGCTTGGAGCCGGCAAGGCCGCGGACTTGACCTATTGGGAGAGTGCAGCTAGGATGATAGCTGATGTTTCAAAGTCTAACAAAATTGTTGTTGAGAAATCCACTGTCCCAGTTAGAACAGCTGAGGCAATTGAGAAAATTCTAACATACAATACTAATAGCAAGGGCATCAAGTATCAAATTCTGTCAAATCCTGAGTTTCTCTCTGAGGGAACAGCTATTCAAGACCTTCTGAACCCTGACCGGGTTCTGATTGGAGGGAATCAATGCCCTGAAGGTTTACAAGCAATTCAAAAACTGAAGGCTATATATGCACATTGGGTGCCTGAAGACAGAATCATAACAACCAATTTGTGGTCTGCAGAACTGTCCAAGTTAGCTGATAATGCCTTTTTGGCACAAAGGATTTCATCTATTAATTCTATGTCTGCCTTATGTGAGGCCACTGGAGCTGAAGTTTCACAAGTTTCTCATGCTCTAAGCAAAAACACCAAAATTGGACCTAAGTTCCTCAATGCTAGTGTTGGTTTTGGTGGCTCTTGTTTTCAAAAGGACATACTCAACTTGGTGTACATATGTGAGAGCAATGGCCTCAATGAAGTGGCTAATTACTGGAAACAAGTGATCAAGATGAATGACTACCAAAAAAATAGGTTTGTGAGGCGGGTCGTGACATCGATGTTCAACACGGTTTCGGGTAAGAAGATTGCAATTCTGGGGTTTGCCTTCAAGAAAGATACTGGTGACACTAGGAAGACTCCTGCAATTGATGTCTGCAAAGGCCTATTGGGAGATAACGCGTGCTTGAGCATCTACGATCCATGTGTTATCGAGGAGCAGATTCAAAAGGATTTGTCAATGGATGGCGTTGAATTTGACCATCCTGTCCACCTGCAGCCAATGAATTCTACTATGGTGAAACAAGTTAGTATTGTTGGGGATGCTTATGAGGCTACTAAAGATGCTCATGGGATATGCATTCTTACAGAGTGGGATGAGTTCAAGAACATTGATTTTCAAAGAGTGTATGACAGCATGCAGAAACCAGCATTTGTGTTTGATGGAAGAAACATATTGAATGCTGAGAAGTTGAGGGAGATTGGATTCATTGTGTACTCAATTGGGAGGCCATTAGAGCAATGGCTAATAAGCATGGCCTAA
Predicted protein sequences of Glyma17g08491
>Glyma17g08491.1   sequence type=predicted peptide   gene model=Glyma17g08491   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVKICGIGAGYVGGPTMAVIALKCPSIEVAVVDISHSRISAWNSNKLPIYEPGLEQVVNQCRGKNLLFSTDVEKHVHEADIVFLSVNTPTKTRGLGAGKAADLTYWESAARMIADVSKSNKIVVEKSTVPVRTAEAIEKILTYNTNSKGIKYQILSNPEFLSEGTAIQDLLNPDRVLIGGNQCPEGLQAIQKLKAIYAHWVPEDRIITTNLWSAELSKLADNAFLAQRISSINSMSALCEATGAEVSQVSHALSKNTKIGPKFLNASVGFGGSCFQKDILNLVYICESNGLNEVANYWKQVIKMNDYQKNRFVRRVVTSMFNTVSGKKIAILGFAFKKDTGDTRKTPAIDVCKGLLGDNACLSIYDPCVIEEQIQKDLSMDGVEFDHPVHLQPMNSTMVKQVSIVGDAYEATKDAHGICILTEWDEFKNIDFQRVYDSMQKPAFVFDGRNILNAEKLREIGFIVYSIGRPLEQWLISMA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo