Warning : Undefined variable $sxsome in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : Undefined variable $sstart in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : Undefined variable $send in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1018
Warning : get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g08450): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1018
Warning : Trying to access array offset on false in
/var/www/html/include/SeqFeatClass.php on line
1019
Warning : get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1020
Warning : get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g08450): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1020
Warning : Trying to access array offset on false in
/var/www/html/include/SeqFeatClass.php on line
1021
Deprecated : preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in
/var/www/html/include/SeqFeatClass.php on line
1025
Deprecated : preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in
/var/www/html/include/SeqFeatClass.php on line
1031
Report for Sequence Feature Glyma17g08450
Feature Type: gene_model
Chromosome: Gm17
Start: 6253558
stop: 6256527
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g08450
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G61210 AT
Annotation by Michelle Graham. TAIR10: soluble N-ethylmaleimide-sensitive factor adaptor protein 33 | chr5:24624027-24625366 FORWARD LENGTH=300
SoyBase E_val: 7.00E-128 ISS
GO:0000165 GO-bp
Annotation by Michelle Graham. GO Biological Process: MAPK cascade
SoyBase N/A ISS
GO:0000910 GO-bp
Annotation by Michelle Graham. GO Biological Process: cytokinesis
SoyBase N/A ISS
GO:0000911 GO-bp
Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation
SoyBase N/A ISS
GO:0002679 GO-bp
Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response
SoyBase N/A ISS
GO:0006499 GO-bp
Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation
SoyBase N/A ISS
GO:0006612 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane
SoyBase N/A ISS
GO:0006820 GO-bp
Annotation by Michelle Graham. GO Biological Process: anion transport
SoyBase N/A ISS
GO:0006862 GO-bp
Annotation by Michelle Graham. GO Biological Process: nucleotide transport
SoyBase N/A ISS
GO:0006888 GO-bp
Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport
SoyBase N/A ISS
GO:0009595 GO-bp
Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus
SoyBase N/A ISS
GO:0009611 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to wounding
SoyBase N/A ISS
GO:0009612 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to mechanical stimulus
SoyBase N/A ISS
GO:0009620 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to fungus
SoyBase N/A ISS
GO:0009625 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to insect
SoyBase N/A ISS
GO:0009627 GO-bp
Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance
SoyBase N/A ISS
GO:0009695 GO-bp
Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process
SoyBase N/A ISS
GO:0009697 GO-bp
Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process
SoyBase N/A ISS
GO:0009737 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus
SoyBase N/A ISS
GO:0009753 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus
SoyBase N/A ISS
GO:0009862 GO-bp
Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway
SoyBase N/A ISS
GO:0009863 GO-bp
Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway
SoyBase N/A ISS
GO:0009867 GO-bp
Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway
SoyBase N/A ISS
GO:0010200 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to chitin
SoyBase N/A ISS
GO:0010310 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process
SoyBase N/A ISS
GO:0010363 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response
SoyBase N/A ISS
GO:0015696 GO-bp
Annotation by Michelle Graham. GO Biological Process: ammonium transport
SoyBase N/A ISS
GO:0015802 GO-bp
Annotation by Michelle Graham. GO Biological Process: basic amino acid transport
SoyBase N/A ISS
GO:0016192 GO-bp
Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport
SoyBase N/A ISS
GO:0030968 GO-bp
Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response
SoyBase N/A ISS
GO:0031348 GO-bp
Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response
SoyBase N/A ISS
GO:0042742 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to bacterium
SoyBase N/A ISS
GO:0043069 GO-bp
Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death
SoyBase N/A ISS
GO:0043090 GO-bp
Annotation by Michelle Graham. GO Biological Process: amino acid import
SoyBase N/A ISS
GO:0043269 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of ion transport
SoyBase N/A ISS
GO:0043900 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process
SoyBase N/A ISS
GO:0045087 GO-bp
Annotation by Michelle Graham. GO Biological Process: innate immune response
SoyBase N/A ISS
GO:0050832 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to fungus
SoyBase N/A ISS
GO:0051707 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to other organism
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0009504 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cell plate
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0016021 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane
SoyBase N/A ISS
GO:0005484 GO-mf
Annotation by Michelle Graham. GO Molecular Function: SNAP receptor activity
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
KOG3065
KOG
SNAP-25 (synaptosome-associated protein) component of SNARE complex
JGI ISS
PTHR19305 Panther
SYNAPTOSOMAL ASSOCIATED PROTEIN
JGI ISS
PF05739 PFAM
SNARE domain
JGI ISS
UniRef100_C6TJG5 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TJG5_SOYBN
SoyBase E_val: 0 ISS
UniRef100_F5C0G9 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: SNAP33 n=1 Tax=Solanum chacoense RepID=F5C0G9_SOLCH
SoyBase E_val: 1.00E-137 ISS
Expression Patterns of Glyma17g08450
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma17g08450
Paralog Evidence Comments
Glyma05g00640 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g08450 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g076600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g08450
Coding sequences of Glyma17g08450
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g08450.1 sequence type=CDS gene model=Glyma17g08450 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTTTGGTTCAAAGAAATCTCCTTTGAAGGTTGCTAAACCTAGCTCCGTTGAGTCTTGGACGAATCCATTTGATTCTAATGATGAGGGAATGGATACCAAAAAGTATAGTTCCTCTAGAAAGACTTCTTCGGAGCGTGCACTTACTACACTGGGAGTTAACACCAACCCCTTTGATGATGGCACTGATGCCAATAAGAAATCTTCATCAACTTTGTATGGCTTTCAATCTGCCAACTGGAACAAGTATAAGAATGATTTCCGTGATTCTGGTGGACTAGAGAATCAATCGGTTCAAGAATTGGAGAGTTATGCTGTTTACAAGGCTGAAGAAACTACAAATTCAGTCACAAATTGTTTGAAGATAGCAGAGAACATAAGAGAGGAGGCTACCCAGACACTAGTCACCCTTCATCAACAGGGTGAACAAATTACCAGGAGTCACCATGTTGCTGCTGACATCGATCATGATCTAACTCGGGGAGAAAAGCTCTTGGGAAGCCTTGGTGGCCTCTTCTCCAAAACTTGGAAACCAAAGAAGACACGTGCAATAACCGGCCCTGTTATTGTTGGAGATGATCCAGTCAGGAGAAAGGGTAATCACTTGGAGCAAAGAGAGAAGTTGGGGCTGACTTCTGCACCCAAAGGGCAGTCCAAGCTACGGTCCCCACCTCAAGAACCAACAAATGCATTTGAAAAAGTTGAGGTTGAGAAAAATAAGCAAGATGATGCACTATCAGATTTAAGTGATCTGTTGGGAGAGCTTAAAGGCATGGCTGTTGACATGGGATCCGAGATTGAGAGGCATAACAAAGCCCTGAATCATCTCTATGATGATGTGGATGAGTTGAATTTCCGAGTGATAGGTGCTAACCAACGTGGACGTCGTTTGCTCGGAAAATAA
Predicted protein sequences of Glyma17g08450
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g08450.1 sequence type=predicted peptide gene model=Glyma17g08450 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MFGSKKSPLKVAKPSSVESWTNPFDSNDEGMDTKKYSSSRKTSSERALTTLGVNTNPFDDGTDANKKSSSTLYGFQSANWNKYKNDFRDSGGLENQSVQELESYAVYKAEETTNSVTNCLKIAENIREEATQTLVTLHQQGEQITRSHHVAADIDHDLTRGEKLLGSLGGLFSKTWKPKKTRAITGPVIVGDDPVRRKGNHLEQREKLGLTSAPKGQSKLRSPPQEPTNAFEKVEVEKNKQDDALSDLSDLLGELKGMAVDMGSEIERHNKALNHLYDDVDELNFRVIGANQRGRRLLGK*