SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g08220): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g08220): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g08220

Feature Type:gene_model
Chromosome:Gm17
Start:6090607
stop:6091629
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G30950AT Annotation by Michelle Graham. TAIR10: fatty acid desaturase 6 | chr4:15057278-15059673 REVERSE LENGTH=448 SoyBaseE_val: 2.00E-86ISS
GO:0000096GO-bp Annotation by Michelle Graham. GO Biological Process: sulfur amino acid metabolic process SoyBaseN/AISS
GO:0006546GO-bp Annotation by Michelle Graham. GO Biological Process: glycine catabolic process SoyBaseN/AISS
GO:0006629GO-bp Annotation by Michelle Graham. GO Biological Process: lipid metabolic process SoyBaseN/AISS
GO:0006633GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process SoyBaseN/AISS
GO:0006636GO-bp Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process SoyBaseN/AISS
GO:0006655GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidylglycerol biosynthetic process SoyBaseN/AISS
GO:0006733GO-bp Annotation by Michelle Graham. GO Biological Process: oxidoreduction coenzyme metabolic process SoyBaseN/AISS
GO:0006766GO-bp Annotation by Michelle Graham. GO Biological Process: vitamin metabolic process SoyBaseN/AISS
GO:0008652GO-bp Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process SoyBaseN/AISS
GO:0009072GO-bp Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family metabolic process SoyBaseN/AISS
GO:0009106GO-bp Annotation by Michelle Graham. GO Biological Process: lipoate metabolic process SoyBaseN/AISS
GO:0009108GO-bp Annotation by Michelle Graham. GO Biological Process: coenzyme biosynthetic process SoyBaseN/AISS
GO:0009117GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide metabolic process SoyBaseN/AISS
GO:0009416GO-bp Annotation by Michelle Graham. GO Biological Process: response to light stimulus SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0010205GO-bp Annotation by Michelle Graham. GO Biological Process: photoinhibition SoyBaseN/AISS
GO:0015994GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll metabolic process SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0016117GO-bp Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process SoyBaseN/AISS
GO:0019216GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of lipid metabolic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0019748GO-bp Annotation by Michelle Graham. GO Biological Process: secondary metabolic process SoyBaseN/AISS
GO:0031408GO-bp Annotation by Michelle Graham. GO Biological Process: oxylipin biosynthetic process SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0044272GO-bp Annotation by Michelle Graham. GO Biological Process: sulfur compound biosynthetic process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0045485GO-mf Annotation by Michelle Graham. GO Molecular Function: omega-6 fatty acid desaturase activity SoyBaseN/AISS
PTHR19353Panther FATTY ACID DESATURASE 2 JGI ISS
PTHR19353:SF7Panther DELTA-6/DELTA-8 SPHINGOLIPID DESATURASE JGI ISS
PF00487PFAM Fatty acid desaturase JGI ISS
UniRef100_P48628UniRef Annotation by Michelle Graham. Most informative UniRef hit: Omega-6 fatty acid desaturase, chloroplastic n=1 Tax=Glycine max RepID=FAD6C_SOYBN SoyBaseE_val: 4.00E-115ISS
UniRef100_UPI000233E3CBUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E3CB related cluster n=1 Tax=unknown RepID=UPI000233E3CB SoyBaseE_val: 6.00E-129ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g08220 not represented in the dataset

Glyma17g08220 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma02g36460 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g074400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g08220.1   sequence type=CDS   gene model=Glyma17g08220   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATATTTAGCCTAAACAGTAATGGGCTTATCCAGAAAGGGTTCAGGCGTCAAAGGAATTTCGTTACTAGGAATAAGGTTACTGTCATACGTGCCGTGGCAATTCCAGTACAACCAGCTCCGGTGGAAAGTGCGGAGTATAGAAAACAACTAGCTGAAGACTACGGTTTCAGGCAAATTGGAGAGTCGCTTCCTGATGATGTTACTTTAAAGGATGTCATCAATTCCCTTCCTAAGGAGGTCTTTGAGATTGATGATGTGAAAGCATGGAAATCTGTTTTGATATCTGTCACTTCTTGTGCACTGGGGATCTTCTTGATTTCCAAAGCTCCCTGGTATCTTCTTCCTCTGGTTTGGGCATGGACAGGGACTGCAATAACTGGGTTCTTTGTTATAGGACATGATTGTGCTCACAAATCATTTTCGTCTAACAAATTGGTAGAGGACATTGTTGGAACTTTGGCCTTTATGCCCCTGATTTATCCATATGAGCCTTGGCGATTTAAGCATGACAGGCATCATGCAAAAACAAACATGTAA

>Glyma17g08220.1   sequence type=predicted peptide   gene model=Glyma17g08220   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
IFSLNSNGLIQKGFRRQRNFVTRNKVTVIRAVAIPVQPAPVESAEYRKQLAEDYGFRQIGESLPDDVTLKDVINSLPKEVFEIDDVKAWKSVLISVTSCALGIFLISKAPWYLLPLVWAWTGTAITGFFVIGHDCAHKSFSSNKLVEDIVGTLAFMPLIYPYEPWRFKHDRHHAKTNM*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo