Glyma17g08110 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g08110

Feature Type:	gene_model
Chromosome:	Gm17
Start:	6001963
stop:	6003654
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g08110

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G31840	AT	Annotation by Michelle Graham. TAIR10: early nodulin-like protein 15 \| chr4:15401798-15402426 FORWARD LENGTH=177	SoyBase	E_val: 1.00E-27	ISS
GO:0000226	GO-bp	Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization	SoyBase	N/A	ISS
GO:0000911	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation	SoyBase	N/A	ISS
GO:0006084	GO-bp	Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process	SoyBase	N/A	ISS
GO:0010075	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth	SoyBase	N/A	ISS
GO:0051225	GO-bp	Annotation by Michelle Graham. GO Biological Process: spindle assembly	SoyBase	N/A	ISS
GO:0051322	GO-bp	Annotation by Michelle Graham. GO Biological Process: anaphase	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0031225	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
PF02298	PFAM	Plastocyanin-like domain	JGI		ISS
UniRef100_I1MT19	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MT19_SOYBN	SoyBase	E_val: 3.00E-170	ISS
UniRef100_Q02917	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Early nodulin-55-2 n=1 Tax=Glycine max RepID=NO552_SOYBN	SoyBase	E_val: 2.00E-130	ISS

Expression Patterns of Glyma17g08110

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g08110

Paralog	Evidence	Comments
Glyma02g36580	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g08110 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g073400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g08110

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g08110

Limit To All Plant Sequences

>Glyma17g08110.1   sequence type=CDS   gene model=Glyma17g08110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGCATCCAATTGTCAAGTGGCTGTCATTCACAACATGCATACCCTATTTATTAATCGTTAATTGGAAAAGCCAAAACCCACTACTATACTGCTTTGCATTGCATATCTCTCTCACACTTCTCTCCCATATTCAATTAATCAATATGGCTTCATGTTTTCCAAATGCATCTCCATTTTTGGTCATGCTCGCAATGTGCCTCTTAATTTCCACCTCTGAAGCTGAAAAATATGTGGTTGGAGGCAGTGAAAAATCCTGGAAGTTTCCTCTCTCAAAACCAGATTCACTCAGCCATTGGGCCAACTCTCACCGATTTAAAATCGGCGACACTCTCATATTTAAATACGAAAAGAGAACAGAGTCAGTGCACGAAGTGAATGAGACGGATTATGAAGGGTGCAACACGGTGGGGAAATACCACATTGTGTTCAACGGTGGCAACACCAAGGTGATGCTTACCAAACCTGGATTCAGACACTTCATTAGTGGAAATCAGAGTCATTGCCAGATGGGGTTAAAGCTGGCTGTGCTTGTCATATCGTCGAACAAAACCAAAAAGAATCTTCTTTCCCCATCTCCTTCGCCTTCACCGCCACCATCATCGTTGCTATCACCATCACCTTCGCCACTTCCAAATAATCAAGGTGTTACTAGTAGTTCAGGTGCGGGATTCATCGGGGTTATGATGTGGTTGATGTTATTGCTTTAA

Predicted protein sequences of Glyma17g08110

Limit To All Plant Sequences

>Glyma17g08110.1   sequence type=predicted peptide   gene model=Glyma17g08110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLHPIVKWLSFTTCIPYLLIVNWKSQNPLLYCFALHISLTLLSHIQLINMASCFPNASPFLVMLAMCLLISTSEAEKYVVGGSEKSWKFPLSKPDSLSHWANSHRFKIGDTLIFKYEKRTESVHEVNETDYEGCNTVGKYHIVFNGGNTKVMLTKPGFRHFISGNQSHCQMGLKLAVLVISSNKTKKNLLSPSPSPSPPPSSLLSPSPSPLPNNQGVTSSSGAGFIGVMMWLMLLL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain