Glyma17g07830 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g07830): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g07830): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g07830

Feature Type:	gene_model
Chromosome:	Gm17
Start:	5792117
stop:	5794531
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g07830

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G02470	AT	Annotation by Michelle Graham. TAIR10: S-adenosylmethionine decarboxylase \| chr3:510223-511323 FORWARD LENGTH=366	SoyBase	E_val: 1.00E-107	ISS
GO:0006596	GO-bp	Annotation by Michelle Graham. GO Biological Process: polyamine biosynthetic process	SoyBase	N/A	ISS
GO:0006597	GO-bp	Annotation by Michelle Graham. GO Biological Process: spermine biosynthetic process	SoyBase	N/A	ISS
GO:0006598	GO-bp	Annotation by Michelle Graham. GO Biological Process: polyamine catabolic process	SoyBase	N/A	ISS
GO:0006623	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole	SoyBase	N/A	ISS
GO:0008295	GO-bp	Annotation by Michelle Graham. GO Biological Process: spermidine biosynthetic process	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009698	GO-bp	Annotation by Michelle Graham. GO Biological Process: phenylpropanoid metabolic process	SoyBase	N/A	ISS
GO:0009805	GO-bp	Annotation by Michelle Graham. GO Biological Process: coumarin biosynthetic process	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0016197	GO-bp	Annotation by Michelle Graham. GO Biological Process: endosomal transport	SoyBase	N/A	ISS
GO:0016458	GO-bp	Annotation by Michelle Graham. GO Biological Process: gene silencing	SoyBase	N/A	ISS
GO:0019079	GO-bp	Annotation by Michelle Graham. GO Biological Process: viral genome replication	SoyBase	N/A	ISS
GO:0042398	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular modified amino acid biosynthetic process	SoyBase	N/A	ISS
GO:0004014	GO-mf	Annotation by Michelle Graham. GO Molecular Function: adenosylmethionine decarboxylase activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
KOG0788	KOG	S-adenosylmethionine decarboxylase	JGI		ISS
PTHR11570	Panther	S-ADENOSYLMETHIONINE DECARBOXYLASE	JGI		ISS
PF01536	PFAM	Adenosylmethionine decarboxylase	JGI		ISS
UniRef100_I1MSY8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: S-adenosylmethionine decarboxylase proenzyme n=1 Tax=Glycine max RepID=I1MSY8_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_I1MSY8	UniRef	Annotation by Michelle Graham. Best UniRef hit: S-adenosylmethionine decarboxylase proenzyme n=1 Tax=Glycine max RepID=I1MSY8_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma17g07830

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g07830 not represented in the dataset	Glyma17g07830 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g07830 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g070500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g07830

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g07830

Limit To All Plant Sequences

>Glyma17g07830.1   sequence type=CDS   gene model=Glyma17g07830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGAGAGTGAGAAAACAGAAGCAGGCTTCGAAGGGTTTGAGAAGCGCGTGGAGATTTCATTTTCATTCAGCGAGAGCGGGGAGCCCAAGAAACTAGGGCTTAGGGCCCTGAGTGGGGCCCAAATAAAGTCAATTCTGGAAGCCGCCCGTTGCAGCATTGTGTCGCAGCTCTCAAATTCGGAATTGGACTCTTACGTGCTCTCTGAGTCCAGCCTCTTTGTCTTCCCTTTGAAGATCATACTGAAAACTTGCGGCACCACCAGGCTCCTCCTATCCGTTAAGCCCATTCTCGACCTTGCAGCTTCACTATCACTCTCTGTTTTCGCCGTTAAGTACTCGCGCGGCTCCTTTCTTTTCCCAAATGACCAGCCTGCCCCTCACGACACTTTCTTAAACGAAGTTGCATTGCTTAATCACTATTTTGCCCATCTTAATGCCAAGGCCTACGTCATCGGCAACCCAAATCGCTGCTGGCACCTCTACTCCGCCTGCGGCGAAGCTGCCACGTTGTCGTTGACCGTTGAAATTTGCATGACCGGGTTGGACCGCGACAAGGCCCGCGTGTTTCACAAGGAATGGGGAGGGGGCAAAATGACGGAAATGTCCGGGATTTCGGAGATTGTTCAGAGTCACGTGATCTGCGACTTCGAGTTTGAGCCGTGCGGGTACTCCATGAATGGGATCGAGGGTGCGGCGTTTTCTACCGTGCACGTGACCCCGGAAAATGGGTTCAGTTATGGAAGCTACGAGGTGCAGGGGTTGGACCCGGGGTCAAATGGTTTCGGGGCGCTGGTGAGAAAGGTGCTCAAGTGCTTTTGCCCCAGTGACTTCTCTGTTGCTGTCACGTGTGAAGTGGGTGCCGAGGACTGGGCCATGTCGGATGCTGACGTGGAGGGGTATTGCTGCCAGAACGTGGTGAAGCAACAGTTGCTGCCGGGGAAGGGCTGTCTAGTTTACCGGACTTACTCCGCTAGAGGCAGAGGGAGAGGGTCGCCCAAAATAGCCATCGTCAAGTGCAGCAATGAGATTGAGAAGGAGGAGCTTGTGCTTTCTTCCTGTCTCACTTCTACTTAG

Predicted protein sequences of Glyma17g07830

Limit To All Plant Sequences

>Glyma17g07830.1   sequence type=predicted peptide   gene model=Glyma17g07830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVESEKTEAGFEGFEKRVEISFSFSESGEPKKLGLRALSGAQIKSILEAARCSIVSQLSNSELDSYVLSESSLFVFPLKIILKTCGTTRLLLSVKPILDLAASLSLSVFAVKYSRGSFLFPNDQPAPHDTFLNEVALLNHYFAHLNAKAYVIGNPNRCWHLYSACGEAATLSLTVEICMTGLDRDKARVFHKEWGGGKMTEMSGISEIVQSHVICDFEFEPCGYSMNGIEGAAFSTVHVTPENGFSYGSYEVQGLDPGSNGFGALVRKVLKCFCPSDFSVAVTCEVGAEDWAMSDADVEGYCCQNVVKQQLLPGKGCLVYRTYSARGRGRGSPKIAIVKCSNEIEKEELVLSSCLTST*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain