Report for Sequence Feature Glyma17g07780
Feature Type: gene_model
Chromosome: Gm17
Start: 5757560
stop: 5759931
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g07780
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G23940 AT
Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF788) | chr2:10184199-10185097 FORWARD LENGTH=173
SoyBase E_val: 2.00E-97 ISS
GO:0006511 GO-bp
Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process
SoyBase N/A ISS
GO:0009853 GO-bp
Annotation by Michelle Graham. GO Biological Process: photorespiration
SoyBase N/A ISS
GO:0051788 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to misfolded protein
SoyBase N/A ISS
GO:0080129 GO-bp
Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly
SoyBase N/A ISS
GO:0005783 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
KOG3269
KOG
Predicted membrane protein
JGI ISS
PTHR13505 Panther
FAMILY NOT NAMED
JGI ISS
PTHR13505:SF2 Panther
SUBFAMILY NOT NAMED
JGI ISS
PF05620 PFAM
Protein of unknown function (DUF788)
JGI ISS
UniRef100_G7JED5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Transmembrane protein-like protein n=1 Tax=Medicago truncatula RepID=G7JED5_MEDTR
SoyBase E_val: 5.00E-102 ISS
UniRef100_I1MSY4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MSY4_SOYBN
SoyBase E_val: 3.00E-126 ISS
Expression Patterns of Glyma17g07780
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma17g07780
Paralog Evidence Comments
Glyma02g36980 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g07780 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g070000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g07780
Coding sequences of Glyma17g07780
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g07780.1 sequence type=CDS gene model=Glyma17g07780 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCGAATCAGGGTGCTAAGAAACGCAAGGAAGAGAACGCTCGTCACATGGCTAGGCTCCGCCAAATCATCATCGCCTGCAACGTTATCTATGTGTTGCTAAGAATGTTGGTGTTCCATTCGAGCTTCACCTGGAAGCACTGGATTGGGTTGATTGTGACTTCTTTGGCATATGTTATTCCCTATCAACAGCTCGCGAAGATGGCGACCCCTGCTTACGCTGAAGATGGTGAACTTTTAGATGGTGGATTTGATATGTCTACAGGTGGAGTTTGTGGATATTTACATGATGTTATCTACATAACATGCTTTGTGCAAGTCATGTCCATCGTCTCTGGAAAGTTCTGGTACACATATCTTGTGATACCGGCTTTTGGAGCATACCAGTCCTTTGGTTTCATTAAAGGATTTTTGCCAGGGGGTTCAGAGGAATCATTTGAAGATGAAAAGACCCGCAAGAAGAGAGAAAAGATGGAGAAGAAGGCATCGAGACCCAAGTTTGCCAAGACAAGAACTAGATAG
Predicted protein sequences of Glyma17g07780
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g07780.1 sequence type=predicted peptide gene model=Glyma17g07780 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MANQGAKKRKEENARHMARLRQIIIACNVIYVLLRMLVFHSSFTWKHWIGLIVTSLAYVIPYQQLAKMATPAYAEDGELLDGGFDMSTGGVCGYLHDVIYITCFVQVMSIVSGKFWYTYLVIPAFGAYQSFGFIKGFLPGGSEESFEDEKTRKKREKMEKKASRPKFAKTRTR*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
