Glyma17g07710 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g07710

Feature Type:	gene_model
Chromosome:	Gm17
Start:	5714721
stop:	5718550
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g07710

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G28060	AT	Annotation by Michelle Graham. TAIR10: Cytochrome c oxidase, subunit Vib family protein \| chr4:13944018-13945602 REVERSE LENGTH=78	SoyBase	E_val: 2.00E-46	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0004129	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cytochrome-c oxidase activity	SoyBase	N/A	ISS
PTHR11387	Panther	CYTOCHROME C OXIDASE POLYPEPTIDE VIB	JGI		ISS
PF02297	PFAM	Cytochrome oxidase c subunit VIb	JGI		ISS
UniRef100_I1MSX7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MSX7_SOYBN	SoyBase	E_val: 2.00E-50	ISS
UniRef100_Q9SXV0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome c oxidase subunit 6b n=1 Tax=Oryza sativa Japonica Group RepID=Q9SXV0_ORYSJ	SoyBase	E_val: 4.00E-45	ISS

Expression Patterns of Glyma17g07710

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g07710

Paralog	Evidence	Comments
Glyma02g37150	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Glyma13g01590	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g07710 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g069400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g07710

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g07710

Limit To All Plant Sequences

>Glyma17g07710.1   sequence type=CDS   gene model=Glyma17g07710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACGGAGATTGAACTGAAAACTGCACCTGCTGATTTTCGTTTTCCTACAACAAATCAAACCAGACATTGTTTCACTCGCTACATAGAGTTTCATAGATGCTTGGCAGCAAAGGGTGAAAACTCAGGTGAATGTGAGAGATTTGCTAAATATTACCGCTCCCTTTGCCCGGGTGAATGGGTTGAAAGGTGGAATGAACAGAGGGAGAATGGGACTTTTCCAGGACCTCTTTGA

Predicted protein sequences of Glyma17g07710

Limit To All Plant Sequences

>Glyma17g07710.1   sequence type=predicted peptide   gene model=Glyma17g07710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTEIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLAAKGENSGECERFAKYYRSLCPGEWVERWNEQRENGTFPGPL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain