SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g07475): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g07475): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g07475

Feature Type:gene_model
Chromosome:Gm17
Start:5475423
stop:5477748
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G11210AT Annotation by Michelle Graham. TAIR10: glutamate receptor 2.5 | chr5:3571214-3574537 REVERSE LENGTH=829 SoyBaseE_val: 2.00E-18ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0006865GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid transport SoyBaseN/AISS
GO:0006874GO-bp Annotation by Michelle Graham. GO Biological Process: cellular calcium ion homeostasis SoyBaseN/AISS
GO:0007186GO-bp Annotation by Michelle Graham. GO Biological Process: G-protein coupled receptor signaling pathway SoyBaseN/AISS
GO:0009416GO-bp Annotation by Michelle Graham. GO Biological Process: response to light stimulus SoyBaseN/AISS
GO:0030003GO-bp Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0004930GO-mf Annotation by Michelle Graham. GO Molecular Function: G-protein coupled receptor activity SoyBaseN/AISS
GO:0004970GO-mf Annotation by Michelle Graham. GO Molecular Function: ionotropic glutamate receptor activity SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0005217GO-mf Annotation by Michelle Graham. GO Molecular Function: intracellular ligand-gated ion channel activity SoyBaseN/AISS
GO:0005234GO-mf Annotation by Michelle Graham. GO Molecular Function: extracellular-glutamate-gated ion channel activity SoyBaseN/AISS
PTHR18966Panther IONOTROPIC GLUTAMATE RECEPTOR-RELATED JGI ISS
PTHR18966:SF6Panther gb def: agcp9714 [anopheles gambiae str. pest] JGI ISS
PF00060PFAM Ligand-gated ion channel JGI ISS
UniRef100_G5EKN3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glutamate receptor n=1 Tax=Solanum lycopersicum RepID=G5EKN3_SOLLC SoyBaseE_val: 5.00E-23ISS
UniRef100_UPI000233BAF8UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233BAF8 related cluster n=1 Tax=unknown RepID=UPI000233BAF8 SoyBaseE_val: 2.00E-44ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g07475 not represented in the dataset

Glyma17g07475 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g067300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g07475.1   sequence type=CDS   gene model=Glyma17g07475   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTATGGCTTCTATTGGCGTTCGTGCTTATGCAAAGTTACACTGCAAACTTGACTTCTATATTGACCTTGGATCAGTTAAGACCCCGTTTTCTGAGAAAAGGGGAGGGTTATTATGTTGGATATCAAACTGGGTCTTTCGTTAAAGATGTGTTATTTAAGCAATTTAAATTTGACCCATCCAAGCTGAGGTCATATAGCAACAGTGCTGAGTATTATAAGGCTTTAAAATCTGGAAGCCAAGGTGGTGGTGTTGCAGCTATATTCGATGAAGTGTCCTACCTTTGCATTCCCTTTAAACTCCAATCTCACGGCTTACTTTTCGAGAGCCATATTGAAGAAGACTGA

>Glyma17g07475.1   sequence type=predicted peptide   gene model=Glyma17g07475   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVWLLLAFVLMQSYTANLTSILTLDQLRPRFLRKGEGYYVGYQTGSFVKDVLFKQFKFDPSKLRSYSNSAEYYKALKSGSQGGGVAAIFDEVSYLCIPFKLQSHGLLFESHIEED*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo