Report for Sequence Feature Glyma17g07410
Feature Type: gene_model
Chromosome: Gm17
Start: 5409890
stop: 5410368
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Expression Patterns of Glyma17g07410
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma17g07410 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma17g07410
Coding sequences of Glyma17g07410
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g07410.1 sequence type=CDS gene model=Glyma17g07410 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
AAGAAATGTGTAGGCTTTATTTCTGATCAATATGTTTTACTTCCCTTTGTAGTCACTGTGATCAACTTATTATTTCGCCACTTGAAATCCTTTATCTTCATCACATCACAGGATATGATACTCTTTGGAGTCTCAAGCCTTGATACATTTGGGCAGGATTAA
Predicted protein sequences of Glyma17g07410
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g07410.1 sequence type=predicted peptide gene model=Glyma17g07410 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
KKCVGFISDQYVLLPFVVTVINLLFRHLKSFIFITSQDMILFGVSSLDTFGQD*