Glyma17g07250 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g07250

Feature Type:	gene_model
Chromosome:	Gm17
Start:	5300170
stop:	5301673
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g07250

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G25810	AT	Annotation by Michelle Graham. TAIR10: xyloglucan endotransglycosylase 6 \| chr4:13128694-13129715 FORWARD LENGTH=286	SoyBase	E_val: 7.00E-158	ISS
GO:0005975	GO-bp	Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process	SoyBase	N/A	ISS
GO:0006073	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular glucan metabolic process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0004553	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds	SoyBase	N/A	ISS
GO:0016762	GO-mf	Annotation by Michelle Graham. GO Molecular Function: xyloglucan:xyloglucosyl transferase activity	SoyBase	N/A	ISS
GO:0016798	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on glycosyl bonds	SoyBase	N/A	ISS
PTHR10963	Panther	SECRETED GLUCOSIDASE-RELATED	JGI		ISS
PTHR10963:SF14	Panther	BETA-GLUCANASE	JGI		ISS
PF00722	PFAM	Glycosyl hydrolases family 16	JGI		ISS
PF06955	PFAM	Xyloglucan endo-transglycosylase (XET) C-terminus	JGI		ISS
UniRef100_G7JD12	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Xyloglucan endotransglucosylase/hydrolase n=1 Tax=Medicago truncatula RepID=G7JD12_MEDTR	SoyBase	E_val: 6.00E-170	ISS
UniRef100_UPI0001B63978	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0001B63978 related cluster n=1 Tax=unknown RepID=UPI0001B63978	SoyBase	E_val: 0	ISS

Proteins Associated with Glyma17g07250

Locus	Gene Symbol	Protein Name
	XTH43f	xyloglucan endotransglycosylase/hydrolase

Expression Patterns of Glyma17g07250

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g07250

Paralog	Evidence	Comments
Glyma13g01140	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g07250 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g065100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g07250

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g07250

Limit To All Plant Sequences

>Glyma17g07250.1   sequence type=CDS   gene model=Glyma17g07250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCTACCTTCTCTCGAAGCCTAGCACTTGTAAGCTTTTACATTGTCGTTTGTGCTGCCGGTAACTTGAACCAAGACTTTCAGCTTACGTGGGGAGATGGTCGTGCTAAAATACTCAACAACGAAAATCTTCTCACTCTCTCCCTTGACAAGGCCTCTGGCTCTGGCTTCCAATCCAAAAACGAATACTTATATGGCAAGATTGACATGCAGCTCAAGCTCGTTCCTGGAAACTCTGCTGGCACTGTCACCGCCTATTATCTGTCTTCAAAAGGATCAACATGGGATGAGATTGACTTCGAGTTCTTGGGGAATCTGAGTGGCGATCCATACATTCTACACACCAATGTGTTCAGCCAAGGCAAGGGCAACAGAGAGCAACAATTCTATCTCTGGTTTGACCCAACTGCAGATTTCCACACTTATTCAATTCTTTGGAATCCCCAACGCATTGTTTTTTCTGTGGATGGCACCCCCATCAGGGAATTCAAGAATTTGGAATCAATAGGAGTTCCTTTTCCAAAGAGCCAACCGATGAGGATATACTCAAGCCTATGGAACGCTGATGATTGGGCCACAAGGGGTGGACTCATCAAGACTGACTGGTCCAAAGCTCCTTTCACTGCATCCTACAGAAACTTCAACGCCAATGCTTGTGTTTGGAACTCTGGAAAATCCTCATGCAAATCAAATTCTTCACCTTCCTCTGCATCTCCCACTAATGCATGGTTATCACAAGAGCTTGATTCCACTGCTCAGCAGAGGTTGCGTTGGGTGCAGAAGAACTACTTGATTTACAATTACTGCACCGACAACAAGAGATTTCCTCAAGGCCTTCCACTCGAATGCAAACACTCCTAG

Predicted protein sequences of Glyma17g07250

Limit To All Plant Sequences

>Glyma17g07250.1   sequence type=predicted peptide   gene model=Glyma17g07250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASTFSRSLALVSFYIVVCAAGNLNQDFQLTWGDGRAKILNNENLLTLSLDKASGSGFQSKNEYLYGKIDMQLKLVPGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNLESIGVPFPKSQPMRIYSSLWNADDWATRGGLIKTDWSKAPFTASYRNFNANACVWNSGKSSCKSNSSPSSASPTNAWLSQELDSTAQQRLRWVQKNYLIYNYCTDNKRFPQGLPLECKHS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain