Report for Sequence Feature Glyma17g07140
Feature Type: gene_model
Chromosome: Gm17
Start: 5200915
stop: 5207483
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g07140
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G57490 AT
Annotation by Michelle Graham. TAIR10: voltage dependent anion channel 4 | chr5:23283895-23285335 REVERSE LENGTH=274
SoyBase E_val: 6.00E-117 ISS
GO:0006820 GO-bp
Annotation by Michelle Graham. GO Biological Process: anion transport
SoyBase N/A ISS
GO:0009617 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to bacterium
SoyBase N/A ISS
GO:0044070 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of anion transport
SoyBase N/A ISS
GO:0055085 GO-bp
Annotation by Michelle Graham. GO Biological Process: transmembrane transport
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0005741 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial outer membrane
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0016020 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: membrane
SoyBase N/A ISS
GO:0008308 GO-mf
Annotation by Michelle Graham. GO Molecular Function: voltage-gated anion channel activity
SoyBase N/A ISS
KOG3126
KOG
Porin/voltage-dependent anion-selective channel protein
JGI ISS
PTHR11743 Panther
VOLTAGE-DEPENDENT ANION-SELECTIVE CHANNEL
JGI ISS
PTHR11743:SF14 Panther
VOLTAGE-DEPENDENT ANION-SELECTIVE CHANNEL-RELATED
JGI ISS
PF01459 PFAM
Eukaryotic porin
JGI ISS
UniRef100_I1MSR7 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MSR7_SOYBN
SoyBase E_val: 0 ISS
UniRef100_Q6W2J1 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: VDAC3.1 n=2 Tax=Lotus japonicus RepID=Q6W2J1_LOTJA
SoyBase E_val: 2.00E-174 ISS
Expression Patterns of Glyma17g07140
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma17g07140
Paralog Evidence Comments
Glyma13g01040 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g07140 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g064100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g07140
Coding sequences of Glyma17g07140
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g07140.1 sequence type=CDS gene model=Glyma17g07140 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCCAATGGTCCAGCACCGTTTTCTGAGATTGGGAAAAGGGCAAAAGACCTTTTATACAAGGATTACAACTTCGATCACAAGTTTAGCCTCTCAATTCCAAACTCCACTGGATTGGGGCTTATAGCAACAGGATTGAAGAAGGATAAACTTTTTGTTGGTGACATAAGTACACTCTACAAGAGTGGAAATACTACAGTGGATGTGAAAGTTGATACATACTCTAATATATATACAAAGGTGACTGTGAATGATATCTTGCATGGTACAAAAGCTGCTTTGAGCTTCAACATACCTGATCACAAGTCAGGAAAGCTGGATGTGCAGTACCTTCATCCTCATGCAGCTGTTGATTCTAGTATTGGTTTGAATCCATCCCCTCTATTGGAGCTTTCAGCTGCAATTGGCAGCAAAGATCTTTGTCTGGGTGCTGAAGTTGGATTTAATACAACTTCTGCTTCGTTCACAAAATATAATGCTGGAGTTGCCTTCAATAAACCAGATTTCTCTGTGGCACTTATGCTGGCTGATAAAGGACAGACCCTGAAGGCATCTTACATTCATTATGTTGATCGCCCTGATGGATTTACGGTTGCTGCTGAAATCTCCCACAGGTTTTCTTCCTTAGAGAACAGATTTACTATTGGGAGCTCGCAGTCAATAGATCCAAAGACAGTTTTAAAGACTCGGTTCAGTGACGATGGCAAAGCTGCCTTCCAATGCCAACGAGCATGGAGGCCAAATTCACTTATAACCCTGTCTGCTGAATATGACTCCACGAAGATCTTTGGTTCATCCACCAAGTTCGGTCTTGCTCTAGCTCTCAAGCCTTAA
Predicted protein sequences of Glyma17g07140
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g07140.1 sequence type=predicted peptide gene model=Glyma17g07140 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MANGPAPFSEIGKRAKDLLYKDYNFDHKFSLSIPNSTGLGLIATGLKKDKLFVGDISTLYKSGNTTVDVKVDTYSNIYTKVTVNDILHGTKAALSFNIPDHKSGKLDVQYLHPHAAVDSSIGLNPSPLLELSAAIGSKDLCLGAEVGFNTTSASFTKYNAGVAFNKPDFSVALMLADKGQTLKASYIHYVDRPDGFTVAAEISHRFSSLENRFTIGSSQSIDPKTVLKTRFSDDGKAAFQCQRAWRPNSLITLSAEYDSTKIFGSSTKFGLALALKP*