Report for Sequence Feature Glyma17g07060
Feature Type: gene_model
Chromosome: Gm17
Start: 5135289
stop: 5136789
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g07060
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G30220 AT
Annotation by Michelle Graham. TAIR10: small nuclear ribonucleoprotein F | chr4:14803100-14804259 REVERSE LENGTH=88
SoyBase E_val: 2.00E-38 ISS
GO:0001510 GO-bp
Annotation by Michelle Graham. GO Biological Process: RNA methylation
SoyBase N/A ISS
GO:0006396 GO-bp
Annotation by Michelle Graham. GO Biological Process: RNA processing
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005730 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleolus
SoyBase N/A ISS
GO:0005732 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: small nucleolar ribonucleoprotein complex
SoyBase N/A ISS
GO:0005829 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosol
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
KOG3482
KOG
Small nuclear ribonucleoprotein (snRNP) SMF
JGI ISS
PTHR11021 Panther
SMALL NUCLEAR RIBONUCLEOPROTEIN F (SNRNP-F)
JGI ISS
PF01423 PFAM
LSM domain
JGI ISS
UniRef100_G7JVF0 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Small nuclear ribonucleoprotein F n=1 Tax=Medicago truncatula RepID=G7JVF0_MEDTR
SoyBase E_val: 6.00E-39 ISS
UniRef100_I1MSQ9 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MSQ9_SOYBN
SoyBase E_val: 5.00E-51 ISS
Expression Patterns of Glyma17g07060
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma17g07060
Paralog Evidence Comments
Glyma20g21250 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g07060 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g063100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g07060
Coding sequences of Glyma17g07060
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g07060.2 sequence type=CDS gene model=Glyma17g07060 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTACTATACCAGTTAATCCCAAGCCTTTCTTGAACAATTTGACTGGGAAGCCTGTAATTGTGAAACTGAAGTGGGGAATGGAGTACAAGGGCTATCTCGTTTCCGTTGATTCCTATATGAACTTGCAGCTGGCCAACACCGAGGAGTACATTGAGGGACAATTTACTGGAAATTTGGGAGAGATTTTAATCAGAAATGACCGTAAGAATCAATGTCATTGTGTCACTGCTTAA
Predicted protein sequences of Glyma17g07060
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g07060.2 sequence type=predicted peptide gene model=Glyma17g07060 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MATIPVNPKPFLNNLTGKPVIVKLKWGMEYKGYLVSVDSYMNLQLANTEEYIEGQFTGNLGEILIRNDRKNQCHCVTA*