SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g06990

Feature Type:gene_model
Chromosome:Gm17
Start:5049840
stop:5052958
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g06990
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G57370AT Annotation by Michelle Graham. TAIR10: unknown protein; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF1777 (InterPro:IPR013957); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr5:23244811-23245470 FORWARD LENGTH=219 SoyBaseE_val: 5.00E-39ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF08648PFAM Protein of unknown function (DUF1777) JGI ISS
UniRef100_G7JVD2UniRef Annotation by Michelle Graham. Most informative UniRef hit: U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein n=1 Tax=Medicago truncatula RepID=G7JVD2_MEDTR SoyBaseE_val: 1.00E-55ISS
UniRef100_I1MSQ0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MSQ0_SOYBN SoyBaseE_val: 1.00E-120ISS

Expression Patterns of Glyma17g06990
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g06990
ParalogEvidenceComments
Glyma13g00900 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g06990 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g062400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g06990
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g06990
>Glyma17g06990.1   sequence type=CDS   gene model=Glyma17g06990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACCGATCGTGACCGCGACCGAGACCGTGACCGAACTCGCGACAGAGAAAGAGAACGAAGAAGAGATAAGGACGATCGTGACCGAGACAGAGACCGAGCACGCAGCAAGAGATCTCGCTCGCGTTCGCCTGACCGTGGCCGCTCCCGCCACGCGCGCTCTCCCTCTCCCAGCGAGCGCTCCCACCGCCGGCGGCATCACCGGACGCCGTCCCCCGACCCGCCGCGGAAGCGCCACCGGAGAGACTCGGCGGAGGAGGATCACAAGGAGACGAAGAAAGCGGTGTCGGACTTCGTGGACGGCATCGTGAAGGAGCAGCAGCAGAAGGAGAACGGAGACGGAGGAGAAGGAGAAGCTGAGGGGAGCGAGGATGAGTTGGAGATAATGAAGATGTTTGGGATTCCCACCGGATTTGACTCCACCAAGGGGAAACCGGTTCCCGGTGCTGACGTCAGCGGCGTCAGAGCCGTCACCAAGCGCCAGCCGCGCCAGTACATGAACCGCCGCGGCGGATTTAATCGCCCATTGCCTGCTGAGAGGAATCGCTAG
Predicted protein sequences of Glyma17g06990
>Glyma17g06990.1   sequence type=predicted peptide   gene model=Glyma17g06990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTDRDRDRDRDRTRDRERERRRDKDDRDRDRDRARSKRSRSRSPDRGRSRHARSPSPSERSHRRRHHRTPSPDPPRKRHRRDSAEEDHKETKKAVSDFVDGIVKEQQQKENGDGGEGEAEGSEDELEIMKMFGIPTGFDSTKGKPVPGADVSGVRAVTKRQPRQYMNRRGGFNRPLPAERNR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo