SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g06450): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g06450): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g06450

Feature Type:gene_model
Chromosome:Gm17
Start:4598261
stop:4600061
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G31550AT Annotation by Michelle Graham. TAIR10: WRKY DNA-binding protein 11 | chr4:15290065-15291458 REVERSE LENGTH=325 SoyBaseE_val: 4.00E-101ISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005516GO-mf Annotation by Michelle Graham. GO Molecular Function: calmodulin binding SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PF03106PFAM WRKY DNA -binding domain JGI ISS
PF10533PFAM Plant zinc cluster domain JGI ISS
UniRef100_C6TKE5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TKE5_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q2PJS0UniRef Annotation by Michelle Graham. Most informative UniRef hit: WRKY13 n=1 Tax=Glycine max RepID=Q2PJS0_SOYBN SoyBaseE_val: 0ISS

LocusGene SymbolProtein Name
WRKY33 WRKY Transcription Factor

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g06450 not represented in the dataset

Glyma17g06450 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma13g00380 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g057100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g06450.1   sequence type=CDS   gene model=Glyma17g06450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGTAGATCTGGCAAATATTAGGATGGAAGAGAATATGGCGATTCAAGAAGCAGCTTCCGCTGGGTTGAAGAGTATGGAGCATCTGATTCGCGTCCTTTCTTCTCAAATCCCTTCTGCTTCGTCTTCTTCTTCTAACGCACACCACCACCGTCTTAATCTCAACCACCTTGACTGCGCGGAAATCACCGACTTCACTGTCTCCAAGTTCAAACAAGTCATCAACTTGTTGAATCGCACCGGCCACGCTCGCTTTCGTCGCGCACCTTCTCATCCTTCTCCTTCAATTTCTCCCTCTCAACCTCAACCTCAGCCACAACCACAACCACAGACGCTGACTCTTGATTTTGCAAAACCTGTTATGGTAAAGTCAAATCCCAACCCTAACCCTTCTTCTACCGATTTGTCGGTTTCTCAATATTCTAAGACCAAGGACACAACCACCTTTAGTATATCCCCTCCCATGTCCACCACCACTTCTTCCTTCCTGTCATCCATCACCGCCGACGGCAGCGTCTCTGACGGCAAGATCGGCCCCGCCATCCTCGCCGCCGGCAAGCCTCCTCTCTCCTCATCCCACCGGAAAAGGTGTCACGACGCCACTCTCTCCGCCGGAAAAGCCTCTTCCTCCGCTCACTGCCATTGCTCCAAGAGAAGGAAATCTCGTGTGAAACGAATGATACGTGTGCCGGCGATAAGTTCGAAGATTGCCGATATCCCAGCGGACGAGTACTCGTGGAGAAAGTATGGTCAAAAACCAATCAAGGGATCACCTTACCCACGAGGGTATTATAAGTGCAGTAGCGTGAGAGGGTGTCCGGCGAGGAAGCACGTGGAGCGAGCCCAGGATGACCCCAACATGCTCATCGTTACCTACGAGGGAGAGCACCGTCATCCGCAACCGCGTCTGCCGGAAACTTCTGCCGGCGCCGCCGCGGATTTTGTCTCTCAGCCTGTTTAA

>Glyma17g06450.1   sequence type=predicted peptide   gene model=Glyma17g06450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVDLANIRMEENMAIQEAASAGLKSMEHLIRVLSSQIPSASSSSSNAHHHRLNLNHLDCAEITDFTVSKFKQVINLLNRTGHARFRRAPSHPSPSISPSQPQPQPQPQPQTLTLDFAKPVMVKSNPNPNPSSTDLSVSQYSKTKDTTTFSISPPMSTTTSSFLSSITADGSVSDGKIGPAILAAGKPPLSSSHRKRCHDATLSAGKASSSAHCHCSKRRKSRVKRMIRVPAISSKIADIPADEYSWRKYGQKPIKGSPYPRGYYKCSSVRGCPARKHVERAQDDPNMLIVTYEGEHRHPQPRLPETSAGAAADFVSQPV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo