Report for Sequence Feature Glyma17g06380
Feature Type: gene_model
Chromosome: Gm17
Start: 4544173
stop: 4545589
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g06380
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G06710 AT
Annotation by Michelle Graham. TAIR10: homeobox from Arabidopsis thaliana | chr5:2068305-2070284 REVERSE LENGTH=336
SoyBase E_val: 2.00E-46 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
GO:0043565 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding
SoyBase N/A ISS
KOG0483
KOG
Transcription factor HEX, contains HOX and HALZ domains
JGI ISS
PTHR24326 Panther
FAMILY NOT NAMED
JGI ISS
PTHR24326:SF218 Panther
JGI ISS
PF00046 PFAM
Homeobox domain
JGI ISS
PF02183 PFAM
Homeobox associated leucine zipper
JGI ISS
UniRef100_G7JT79 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Homeobox-leucine zipper protein n=1 Tax=Medicago truncatula RepID=G7JT79_MEDTR
SoyBase E_val: 7.00E-63 ISS
UniRef100_I1MSI4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MSI4_SOYBN
SoyBase E_val: 2.00E-149 ISS
Expression Patterns of Glyma17g06380
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma17g06380
Paralog Evidence Comments
Glyma13g00310 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g06380 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g056300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g06380
Coding sequences of Glyma17g06380
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g06380.1 sequence type=CDS gene model=Glyma17g06380 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAAGACAATAATGAAGAATGCATCGCGGGGCTATGTTTGGGACTGGGACTGGGATTGGGATCAGGACATGTTCCAAAGAAGAATAAGCAGAAAGAGAACAAGGCTGTGGTGTGCCTAGACCTAGCGTTTGAGCTTTGTCCAAAAGGAGAAAAAGCCGTTAATAACGTGAATCATCATCATGATAAGGTAGAGAGAATCAGCTTGGAGAGAATCCACGACTACCCCAATGAAAAGAGCACTGATTCTGATAACAGCAACAACAACGGATGCAGAAAGAAACTGAGGCTTTCCAAGGATCAATCATCCATGCTTGAGAACAGCTTCAAACAGCATAGCACTCTTAATCCGGTCCAGAAACAAGCACTTGCTGATCAATTGAATTTAAAAACTAGACAAGTTGAAGTTTGGTTTCAGAACAGAAGAGCAAGGACCAAACTGAAGCAGACAGAAGTGAACCGCGAGTTGCTGAAAAAACACTGTCAAAATCTAAGCGATGAGAACAAAAGATTGAAGAAGGAATTGCAGGAACTACGTGCAGTTAAGGTTGGACCGTCGCCACCATGCATTCAACTATCCAAAACGGCGACCCTGACTATGTGTTCTTTGTGCCAGAAACTAGTAAATTAA
Predicted protein sequences of Glyma17g06380
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g06380.1 sequence type=predicted peptide gene model=Glyma17g06380 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEDNNEECIAGLCLGLGLGLGSGHVPKKNKQKENKAVVCLDLAFELCPKGEKAVNNVNHHHDKVERISLERIHDYPNEKSTDSDNSNNNGCRKKLRLSKDQSSMLENSFKQHSTLNPVQKQALADQLNLKTRQVEVWFQNRRARTKLKQTEVNRELLKKHCQNLSDENKRLKKELQELRAVKVGPSPPCIQLSKTATLTMCSLCQKLVN*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
