SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma17g06260

Feature Type:gene_model
Chromosome:Gm17
Start:4442652
stop:4445027
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G29735AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Uncharacterised protein family UPF0197 (InterPro:IPR007915); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr4:14562962-1 SoyBaseE_val: 3.00E-26ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG4452 KOG Predicted membrane protein JGI ISS
PTHR13636Panther UNCHARACTERIZED JGI ISS
PF05251PFAM Uncharacterised protein family (UPF0197) JGI ISS
UniRef100_E3TFJ8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Nef1 n=1 Tax=Ictalurus punctatus RepID=E3TFJ8_ICTPU SoyBaseE_val: 2.00E-15ISS
UniRef100_I1MSH1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MSH1_SOYBN SoyBaseE_val: 2.00E-44ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g054900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g06260.1   sequence type=CDS   gene model=Glyma17g06260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCACCAAAACCGATAACGAGTCCCGTCCCCGATTCGTGGTACCCCACACTCTCCGTCTTCACTCTCGCCATCGGCCTCGTCTTAACCGCCTCTTTCTTCATTTATGAAGCAACATCTTCTAGGAAAAGTCGTTCACTTGTTCAGGAGCTGACAACTGGAGCAGTGGCTTCAGTCTTCTTGGGTTTTGGGTCCCTGTTCCTCCTACTTGCTTCTGGCGTTTATGTCTAA

>Glyma17g06260.1   sequence type=predicted peptide   gene model=Glyma17g06260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPKPITSPVPDSWYPTLSVFTLAIGLVLTASFFIYEATSSRKSRSLVQELTTGAVASVFLGFGSLFLLLASGVYV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo