SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g05951): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g05951): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g05951

Feature Type:gene_model
Chromosome:Gm17
Start:4192691
stop:4194562
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g05951
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G20610AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G26160.1); Has 918 Blast hits to 759 proteins in 180 species: Archae - 6; Bacteria - 105; Metazoa - 264; Fungi - 89; Plants - 167; Viruses - 5; Other Eukaryotes - 282 (source: NCBI BLink). | chr5:6969184-6972794 FORWARD LENGTH=1164 SoyBaseE_val: 7.00E-40ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF01476PFAM LysM domain JGI ISS
UniRef100_A5B9N2UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5B9N2_VITVI SoyBaseE_val: 4.00E-60ISS

Expression Patterns of Glyma17g05951
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g05951 not represented in the dataset
Glyma17g05951 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g05951 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g051700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g05951
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g05951
>Glyma17g05951.1   sequence type=CDS   gene model=Glyma17g05951   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGCCACTTGGAATACCAATGCTTTCTCTTACAAGTTGAGAGAGTGTTTGTCCCACCAAAGCAAAAGATTTACAGGCATGTCTCTGAAGCGGGAAAAAATAATCATGAGTGTGAAATAGTAGCCAAGGTGGAGATGAAGGCCAACAAAGAAGAGAAAAATTCTGAAGAGGAAGCCATTCATCAGTTCAGAATTACAGAAGTACATGTTGCAGGTCTGAAGACTGAGCCTCTCAAAAAGAAGTTTTGGGGCACTTCAAGACGACAACAACAGCAACAGTCTGGTTCTCGCTGGTTGATTGCTAATGGAATGGGGAAGAACAATAAGAATTCATTGGTGAAGTCAAAGGTTGTATCTAAATCAAGTGCTCCAATCACCACCGCAAACGTGCAACCCGGTGACACATTGTGGAGCATATCACCTCGTATTTATGGTACTGGAACAAGATGGAAGGAATTGAAAGAGCTAAATCCACATATAAGAAATCCCAATATCAAAATACCAAATAAAACTAGTACGTGGAGTGCACGATTCAATTTTTTGCTATAA
Predicted protein sequences of Glyma17g05951
>Glyma17g05951.1   sequence type=predicted peptide   gene model=Glyma17g05951   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSHLEYQCFLLQVERVFVPPKQKIYRHVSEAGKNNHECEIVAKVEMKANKEEKNSEEEAIHQFRITEVHVAGLKTEPLKKKFWGTSRRQQQQQSGSRWLIANGMGKNNKNSLVKSKVVSKSSAPITTANVQPGDTLWSISPRIYGTGTRWKELKELNPHIRNPNIKIPNKTSTWSARFNFLL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo