Report for Sequence Feature Glyma17g05710
Feature Type: gene_model
Chromosome: Gm17
Start: 4023991
stop: 4027123
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g05710
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G06010 AT
Annotation by Michelle Graham. TAIR10: OBP3-responsive gene 4 | chr2:2336841-2338391 FORWARD LENGTH=188
SoyBase E_val: 1.00E-105 ISS
GO:0009751 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0009536 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plastid
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1MSA6 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MSA6_SOYBN
SoyBase E_val: 2.00E-138 ISS
UniRef100_Q8VY85 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: OBP3-responsive protein 4 n=1 Tax=Arabidopsis thaliana RepID=Q8VY85_ARATH
SoyBase E_val: 5.00E-103 ISS
Expression Patterns of Glyma17g05710
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma17g05710
Paralog Evidence Comments
Glyma13g17010 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g05710 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g049400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g05710
Coding sequences of Glyma17g05710
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g05710.1 sequence type=CDS gene model=Glyma17g05710 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAATCGGTGCCAAACCCAAACAACGGGGAGGAACCCACTTCGTGGGATGAGCTATACAACATCAATTTGATGCCTTCAGAGTTATTTCTCAAGTTCCGAAAAGAACTTCAGGGCATTCGAGTTGGTCTCAATATGGAGTTCTATAATGCCCCAGTCAATGAATATCAAGCAAAGCTTGTATTGAAGCCTTTAACACCTGAATGGAAGTGGAAGATAATCTATGAGCCCCTTCATCAAGATGTTCGTGTTCTTTCAAAAAAGATCCCCATCACTAAATTTCTTAATCTTCAGGTTGGTGTGGGACACAATTTTCAAATGCATGCTACTGGTTGGAAATGGAAGCTCACCACATGTTTGGGTGGAGATGGTATATCCCGGATCCGAAATAAGACATCAATTGGCTTGTTTCCCGGTTTTGATTTACGGTTTGGATGGAGAGCAGACTATGTTCTTCCTGAAATTACTGGGGCACTGGGTACTGATGAGCCAATGTTCAACATGCACTCAGGACGGCTACAAGCATCACTAGATAGAGTTGAGGCCATCTTAACCCACACTGATGCTCCTTGA
Predicted protein sequences of Glyma17g05710
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g05710.1 sequence type=predicted peptide gene model=Glyma17g05710 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MESVPNPNNGEEPTSWDELYNINLMPSELFLKFRKELQGIRVGLNMEFYNAPVNEYQAKLVLKPLTPEWKWKIIYEPLHQDVRVLSKKIPITKFLNLQVGVGHNFQMHATGWKWKLTTCLGGDGISRIRNKTSIGLFPGFDLRFGWRADYVLPEITGALGTDEPMFNMHSGRLQASLDRVEAILTHTDAP*