Glyma17g05310 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g05310

Feature Type:	gene_model
Chromosome:	Gm17
Start:	3667082
stop:	3668908
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g05310

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G44735	AT	Annotation by Michelle Graham. TAIR10: PHYTOSULFOKINE 3 PRECURSOR \| chr3:16291388-16292118 REVERSE LENGTH=81	SoyBase	E_val: 8.00E-14	ISS
GO:0008283	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell proliferation	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0008083	GO-mf	Annotation by Michelle Graham. GO Molecular Function: growth factor activity	SoyBase	N/A	ISS
PF06404	PFAM	Phytosulfokine precursor protein (PSK)	JGI		ISS
UniRef100_I1MS63	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MS63_SOYBN	SoyBase	E_val: 7.00E-60	ISS
UniRef100_Q5IVZ8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Phytosulfokine n=1 Tax=Avicennia marina RepID=Q5IVZ8_AVIMR	SoyBase	E_val: 5.00E-08	ISS

Expression Patterns of Glyma17g05310

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g05310

Paralog	Evidence	Comments
Glyma12g30650	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g05310 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.13g319200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g05310

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g05310

Limit To All Plant Sequences

>Glyma17g05310.1   sequence type=CDS   gene model=Glyma17g05310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGATAAGTCTTCACCTTGGAGCTCTCCTCTTTTTTTTGTTCTTCCTAGTTTCCTCATCAAAGCTATCTGCTAGACCACTCACCACCGAACAAGGGAGAGACAGATCAAAACTGAATGAGGTCTCAGGGGAGGACTTGGTGTTGGAGTTGGAAGGAGGTGAATCTTTGAAGCTGCTGGGGGTGGAGGACTGCAAAAGTGGAGATGAAGAATGTTTGCAGAGAAGAATGACTTTAGCAGCTCACCTAGACTACATCTACACCCAGCACCATAAGCCTTGA

Predicted protein sequences of Glyma17g05310

Limit To All Plant Sequences

>Glyma17g05310.1   sequence type=predicted peptide   gene model=Glyma17g05310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKISLHLGALLFFLFFLVSSSKLSARPLTTEQGRDRSKLNEVSGEDLVLELEGGESLKLLGVEDCKSGDEECLQRRMTLAAHLDYIYTQHHKP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain