SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma17g05310

Feature Type:gene_model
Chromosome:Gm17
Start:3667082
stop:3668908
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G44735AT Annotation by Michelle Graham. TAIR10: PHYTOSULFOKINE 3 PRECURSOR | chr3:16291388-16292118 REVERSE LENGTH=81 SoyBaseE_val: 8.00E-14ISS
GO:0008283GO-bp Annotation by Michelle Graham. GO Biological Process: cell proliferation SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0008083GO-mf Annotation by Michelle Graham. GO Molecular Function: growth factor activity SoyBaseN/AISS
PF06404PFAM Phytosulfokine precursor protein (PSK) JGI ISS
UniRef100_I1MS63UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MS63_SOYBN SoyBaseE_val: 7.00E-60ISS
UniRef100_Q5IVZ8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phytosulfokine n=1 Tax=Avicennia marina RepID=Q5IVZ8_AVIMR SoyBaseE_val: 5.00E-08ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma12g30650 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g319200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g05310.1   sequence type=CDS   gene model=Glyma17g05310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGATAAGTCTTCACCTTGGAGCTCTCCTCTTTTTTTTGTTCTTCCTAGTTTCCTCATCAAAGCTATCTGCTAGACCACTCACCACCGAACAAGGGAGAGACAGATCAAAACTGAATGAGGTCTCAGGGGAGGACTTGGTGTTGGAGTTGGAAGGAGGTGAATCTTTGAAGCTGCTGGGGGTGGAGGACTGCAAAAGTGGAGATGAAGAATGTTTGCAGAGAAGAATGACTTTAGCAGCTCACCTAGACTACATCTACACCCAGCACCATAAGCCTTGA

>Glyma17g05310.1   sequence type=predicted peptide   gene model=Glyma17g05310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKISLHLGALLFFLFFLVSSSKLSARPLTTEQGRDRSKLNEVSGEDLVLELEGGESLKLLGVEDCKSGDEECLQRRMTLAAHLDYIYTQHHKP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo