SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g05230

Feature Type:gene_model
Chromosome:Gm17
Start:3576731
stop:3578479
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g05230
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G20720AT Annotation by Michelle Graham. TAIR10: chaperonin 20 | chr5:7015015-7016354 FORWARD LENGTH=253 SoyBaseE_val: 9.00E-110ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009658GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast organization SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:1901671GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of superoxide dismutase activity SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005516GO-mf Annotation by Michelle Graham. GO Molecular Function: calmodulin binding SoyBaseN/AISS
KOG1641 KOG Mitochondrial chaperonin JGI ISS
PTHR10772Panther GROES CHAPERONIN JGI ISS
PTHR10772:SF0Panther 10 KDA HEAT SHOCK PROTEIN JGI ISS
PF00166PFAM Chaperonin 10 Kd subunit JGI ISS
UniRef100_G7JS70UniRef Annotation by Michelle Graham. Most informative UniRef hit: 20 kDa chaperonin n=2 Tax=Medicago truncatula RepID=G7JS70_MEDTR SoyBaseE_val: 3.00E-120ISS
UniRef100_I1MS56UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1MS56_SOYBN SoyBaseE_val: 5.00E-132ISS

Expression Patterns of Glyma17g05230
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g05230
ParalogEvidenceComments
Glyma13g17260 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g05230 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g047200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g05230
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Transcripts of Glyma17g05230
>Glyma17g05230.2   sequence type=transcript   gene model=Glyma17g05230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AGGTTTTTTCTTGTTCAATGTTACATGTATGTCTGATTGTATTTCACAATGCAGCACACCACTGTTAAGCCTCTGGGTGATAGAGTACTGGTGAAAATTAAGGATGCAGAGGAGAAGACTGCAGGTGGGATTTTACTGCCAGCAAATGCTCAAGGCAAGCCTCAAGGGGGTGAAGTGGTTGCTGTTGGAGAAGGGAAGTCGGTTGGGAAGTGCAAAGTGGATGTTAGTGTGAAGTTGTTTGTACAGACAGGTGCACAAGTTGTGCATTCAAAGTATGCAGGGACTGAGGTAGAGTTCAATGGTTCAAAACATCTTATTCTGAAGGACGATGACATTGTTGGTATCCTTGAAACTGATGAGGTCAAGGATCTTAAACCCTTGAACGATAGAGTCTTGATAAAGGTTGCAGAAGCTGAGGAAAAAACTGCTGGAGGTTTGTTGCTCACAGAGGCAACCAAGGAGAAACCATCTATTGGAACAGTGATAGCAGTTGGTCCGGGGCCTCTGGATGAGGAAGGTAACAGAAAGCCATTGTCCGTCATGCCTGGGAATACAGTTCTGTACTCCAGATATGCAGGGAATGACTTCAAGGGCAAAGATGGTTCTGACTACATTGCCTTGAGGGCCTCAGATGTCATGGCTATCCTGTCCTAGTCAGAATCAGTATTTAGTAACAAATATTTTTTTGTTCTGTAACCAAAATTTGAGTTAATGTCGAGGGAAATGGATACTTATGTTGTGACGACAGCTTGAAATTGTAGCTGATTGCAACTCTGTTCCTTAGACAATTTTGCATTAAATTGAAACGCTTGAAATATGTTTAGTTTCTACGCCCTTTCAACTTCCCTCTCTTGTATGTGGATACTTCCATTTAGCCTATTTGCATTGCATAAAATTAGAAAGCTTTTAAGAAGAAAAAAAGTGGGATCTTCCCTTTAAGAGCAAATGTATGAGGTCATGGACCGTAAGCTTGAGAAGGCATCGTTCTATTAAGG
Coding sequences of Glyma17g05230
>Glyma17g05230.1   sequence type=CDS   gene model=Glyma17g05230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGCACACCACTGTTAAGCCTCTGGGTGATAGAGTACTGGTGAAAATTAAGGATGCAGAGGAGAAGACTGCAGGTGGGATTTTACTGCCAGCAAATGCTCAAGGCAAGCCTCAAGGGGGTGAAGTGGTTGCTGTTGGAGAAGGGAAGTCGGTTGGGAAGTGCAAAGTGGATGTTAGTGTGAAGACAGGTGCACAAGTTGTGCATTCAAAGTATGCAGGGACTGAGGTAGAGTTCAATGGTTCAAAACATCTTATTCTGAAGGACGATGACATTGTTGGTATCCTTGAAACTGATGAGGTCAAGGATCTTAAACCCTTGAACGATAGAGTCTTGATAAAGGTTGCAGAAGCTGAGGAAAAAACTGCTGGAGGTTTGTTGCTCACAGAGGCAACCAAGGAGAAACCATCTATTGGAACAGTGATAGCAGTTGGTCCGGGGCCTCTGGATGAGGAAGGTAACAGAAAGCCATTGTCCGTCATGCCTGGGAATACAGTTCTGTACTCCAGATATGCAGGGAATGACTTCAAGGGCAAAGATGGTTCTGACTACATTGCCTTGAGGGCCTCAGATGTCATGGCTATCCTGTCCTAG

>Glyma17g05230.2   sequence type=CDS   gene model=Glyma17g05230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGCACACCACTGTTAAGCCTCTGGGTGATAGAGTACTGGTGAAAATTAAGGATGCAGAGGAGAAGACTGCAGGTGGGATTTTACTGCCAGCAAATGCTCAAGGCAAGCCTCAAGGGGGTGAAGTGGTTGCTGTTGGAGAAGGGAAGTCGGTTGGGAAGTGCAAAGTGGATGTTAGTGTGAAGTTGTTTGTACAGACAGGTGCACAAGTTGTGCATTCAAAGTATGCAGGGACTGAGGTAGAGTTCAATGGTTCAAAACATCTTATTCTGAAGGACGATGACATTGTTGGTATCCTTGAAACTGATGAGGTCAAGGATCTTAAACCCTTGAACGATAGAGTCTTGATAAAGGTTGCAGAAGCTGAGGAAAAAACTGCTGGAGGTTTGTTGCTCACAGAGGCAACCAAGGAGAAACCATCTATTGGAACAGTGATAGCAGTTGGTCCGGGGCCTCTGGATGAGGAAGGTAACAGAAAGCCATTGTCCGTCATGCCTGGGAATACAGTTCTGTACTCCAGATATGCAGGGAATGACTTCAAGGGCAAAGATGGTTCTGACTACATTGCCTTGAGGGCCTCAGATGTCATGGCTATCCTGTCCTAG
Predicted protein sequences of Glyma17g05230
>Glyma17g05230.1   sequence type=predicted peptide   gene model=Glyma17g05230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQHTTVKPLGDRVLVKIKDAEEKTAGGILLPANAQGKPQGGEVVAVGEGKSVGKCKVDVSVKTGAQVVHSKYAGTEVEFNGSKHLILKDDDIVGILETDEVKDLKPLNDRVLIKVAEAEEKTAGGLLLTEATKEKPSIGTVIAVGPGPLDEEGNRKPLSVMPGNTVLYSRYAGNDFKGKDGSDYIALRASDVMAILS*

>Glyma17g05230.2   sequence type=predicted peptide   gene model=Glyma17g05230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQHTTVKPLGDRVLVKIKDAEEKTAGGILLPANAQGKPQGGEVVAVGEGKSVGKCKVDVSVKLFVQTGAQVVHSKYAGTEVEFNGSKHLILKDDDIVGILETDEVKDLKPLNDRVLIKVAEAEEKTAGGLLLTEATKEKPSIGTVIAVGPGPLDEEGNRKPLSVMPGNTVLYSRYAGNDFKGKDGSDYIALRASDVMAILS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo