SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g05150

Feature Type:gene_model
Chromosome:Gm17
Start:3484894
stop:3487546
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g05150
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G26060AT Annotation by Michelle Graham. TAIR10: Thioredoxin superfamily protein | chr3:9524807-9526123 FORWARD LENGTH=216 SoyBaseE_val: 4.00E-103ISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0016117GO-bp Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0019761GO-bp Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009533GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stromal thylakoid SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0010287GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0016209GO-mf Annotation by Michelle Graham. GO Molecular Function: antioxidant activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0051920GO-mf Annotation by Michelle Graham. GO Molecular Function: peroxiredoxin activity SoyBaseN/AISS
KOG0855 KOG Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes JGI ISS
PTHR10681Panther PEROXIREDOXIN JGI ISS
PTHR10681:SF5Panther UNCHARACTERIZED JGI ISS
PF00578PFAM AhpC/TSA family JGI ISS
UniRef100_I1MS47UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MS47_SOYBN SoyBaseE_val: 5.00E-154ISS
UniRef100_Q6QPJ6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peroxiredoxin Q, chloroplastic n=2 Tax=Populus RepID=PRXQ_POPJC SoyBaseE_val: 3.00E-114ISS

Expression Patterns of Glyma17g05150
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g05150
ParalogEvidenceComments
Glyma13g17350 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g05150 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g046500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g05150
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g05150
>Glyma17g05150.1   sequence type=CDS   gene model=Glyma17g05150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATCCCTCACTGTCCCAAACCATTGTGTTCCCACCTTGCTTCGCACTCACTCTCCCAACCACCCATCTTCCCAAAACCTCCCATTTCCTTCCACACCATCAAATTCTCAATTTTTCGGCCTCAAGTTATCTCATTCTTCCGTTTCATCGATCCCTTCATCTTCTTCACTCAAAGGCACCATTTTCGCCAAGGTGAATAAAGGTTCAAAGCCACCGAATTTTACGCTGAAAGATCAGAATGGGAAGAATGTGAGCCTCTCCAACTTCAAAGGAAAACCAGTAATTGTGTATTTCTACCCTGCTGATGAGACCCCTGGCTGTACCAAACAGGCTTGCGCTTTCAGGGATTCATACGAGAAGTTCAAGAAAGCAGGAGCAGTGGTTGTTGGGATAAGTGGTGATGATGCTGCCTCTCACAAGGCATTTGCCAGCAAGTACAGGCTTCCATTTACTTTGTTGAGTGATGAGGGTAACAAGGTGAGGAAAGAATGGGGAGTGCCAGGTGATTTCTTTGGATCATTGCCTGGAAGAGAGACTTATGTTCTTGACAAAAATGGGGTGGTTCAGCTCGTCTACAACAATCAGTTCCAACCAGAAAAGCATATCGATGAGACCCTCAAAATACTTCAGAGTCTTTGA
Predicted protein sequences of Glyma17g05150
>Glyma17g05150.1   sequence type=predicted peptide   gene model=Glyma17g05150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASLTVPNHCVPTLLRTHSPNHPSSQNLPFPSTPSNSQFFGLKLSHSSVSSIPSSSSLKGTIFAKVNKGSKPPNFTLKDQNGKNVSLSNFKGKPVIVYFYPADETPGCTKQACAFRDSYEKFKKAGAVVVGISGDDAASHKAFASKYRLPFTLLSDEGNKVRKEWGVPGDFFGSLPGRETYVLDKNGVVQLVYNNQFQPEKHIDETLKILQSL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo