Glyma17g05054 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g05054): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g05054): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g05054

Feature Type:	gene_model
Chromosome:	Gm17
Start:	3408976
stop:	3409595
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g05054

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G23630	AT	Annotation by Michelle Graham. TAIR10: isopentenyltransferase 7 \| chr3:8488878-8489867 FORWARD LENGTH=329	SoyBase	E_val: 2.00E-10	ISS
GO:0007131	GO-bp	Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination	SoyBase	N/A	ISS
GO:0008033	GO-bp	Annotation by Michelle Graham. GO Biological Process: tRNA processing	SoyBase	N/A	ISS
GO:0009691	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytokinin biosynthetic process	SoyBase	N/A	ISS
GO:0009860	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen tube growth	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0009824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: AMP dimethylallyltransferase activity	SoyBase	N/A	ISS
GO:0016765	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring alkyl or aryl (other than methyl) groups	SoyBase	N/A	ISS
GO:0052622	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP dimethylallyltransferase activity	SoyBase	N/A	ISS
GO:0052623	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ADP dimethylallyltransferase activity	SoyBase	N/A	ISS
UniRef100_I1MR94	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MR94_SOYBN	SoyBase	E_val: 3.00E-29	ISS
UniRef100_Q2MHM8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Adenylate isopentenyltransferase n=1 Tax=Pisum sativum RepID=Q2MHM8_PEA	SoyBase	E_val: 7.00E-15	ISS

Expression Patterns of Glyma17g05054

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g05054 not represented in the dataset	Glyma17g05054 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g05054 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g045700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g05054

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g05054

Limit To All Plant Sequences

>Glyma17g05054.1   sequence type=CDS   gene model=Glyma17g05054   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGGAAACGGAACATGCACCGCCTCGACGCCACCGAGGTTTTTCTCAAGAACGCTACTCGCCAGGAGGAGGCGTGGGAGGATCACGTGTTGTCCAAGAGCAGAAGGATTCTCCATAAGTTTCTGTATGAGGATACGCATGTCGTTCCCGCATGTATTGCTGCGTCAGTTGTTATTGCTTCTTCGCTGCCAGCCATGGCTGCTGCCGCCGCCGCCGCAACTCACTAG

Predicted protein sequences of Glyma17g05054

Limit To All Plant Sequences

>Glyma17g05054.1   sequence type=predicted peptide   gene model=Glyma17g05054   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MWKRNMHRLDATEVFLKNATRQEEAWEDHVLSKSRRILHKFLYEDTHVVPACIAASVVIASSLPAMAAAAAAATH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain