SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g04750

Feature Type:gene_model
Chromosome:Gm17
Start:3183098
stop:3184828
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g04750
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G17590AT Annotation by Michelle Graham. TAIR10: transcription regulatory protein SNF5, putative (BSH) | chr3:6017313-6019591 REVERSE LENGTH=240 SoyBaseE_val: 4.00E-87ISS
GO:0006338GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin remodeling SoyBaseN/AISS
GO:0040029GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of gene expression, epigenetic SoyBaseN/AISS
GO:0000228GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nuclear chromosome SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003682GO-mf Annotation by Michelle Graham. GO Molecular Function: chromatin binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR10019Panther SNF5 JGI ISS
PF04855PFAM SNF5 / SMARCB1 / INI1 JGI ISS
UniRef100_D7RJ53UniRef Annotation by Michelle Graham. Most informative UniRef hit: SNF5 n=1 Tax=Glycine max RepID=D7RJ53_SOYBN SoyBaseE_val: 2.00E-95ISS
UniRef100_UPI000233DF8AUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233DF8A related cluster n=1 Tax=unknown RepID=UPI000233DF8A SoyBaseE_val: 6.00E-103ISS

Expression Patterns of Glyma17g04750
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g04750
ParalogEvidenceComments
Glyma13g17760 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g04750 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g042700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g04750
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g04750
>Glyma17g04750.2   sequence type=CDS   gene model=Glyma17g04750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAACCACGATTTCGTGTTTCTACAGAAACCCCGTCAAGTTCAGAATGCCAACTGCGGAGAACTTGGTTCCCATTCGATTGGACATCGAAATCGAGGGGCAGAGATACAAGGACGCGCTCACTTGGAACCCTTCTGATCCCGATTCTGAGGTTGTCGTCTTTGCAAAAAGGACTGCTAAAGACTTGAAGCTCCCTCCCGTTTTTGTAACACAAATTGCTCAATCAATTCAACTTGATCTTCGTGTTAATCATACGCTCGTGAAGGACCAGTTTTTATGGGACTCGAACAACTTTGAGAGTGATCCTAAAGAGTTTGCCAGACTCTTCTGCAAGGACACGGGCATTGAAGATCCCGAGGTTGGACCAGCTATTGCCTTTGCTATCAGAGAGCAGCTTAATGAGATTGCAATTCAAAGTGTGGTTTCAGCAAGAGAAAGCAGAATGAGCAAGAAGGGTCGTTGA
Predicted protein sequences of Glyma17g04750
>Glyma17g04750.2   sequence type=predicted peptide   gene model=Glyma17g04750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKTTISCFYRNPVKFRMPTAENLVPIRLDIEIEGQRYKDALTWNPSDPDSEVVVFAKRTAKDLKLPPVFVTQIAQSIQLDLRVNHTLVKDQFLWDSNNFESDPKEFARLFCKDTGIEDPEVGPAIAFAIREQLNEIAIQSVVSARESRMSKKGR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo