Glyma17g04730 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g04730

Feature Type:	gene_model
Chromosome:	Gm17
Start:	3166732
stop:	3167609
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g04730

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G05858	AT	Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G26620.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). \| chr3:1749464-1749736 FORWARD LENGTH=90	SoyBase	E_val: 3.00E-15	ISS
UniRef100_I1MS03	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MS03_SOYBN	SoyBase	E_val: 6.00E-41	ISS
UniRef100_Q9LUP0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Gb\|AAD49764.1 n=1 Tax=Arabidopsis thaliana RepID=Q9LUP0_ARATH	SoyBase	E_val: 5.00E-12	ISS

Expression Patterns of Glyma17g04730

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g04730

Paralog	Evidence	Comments
Glyma13g17780	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g04730 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g042500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g04730

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g04730

Limit To All Plant Sequences

>Glyma17g04730.2   sequence type=CDS   gene model=Glyma17g04730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGGCTAAGAAATCATCATCTTCTTTCTCCTTTTGTGGTATGTTCAAGGCTTGTTTCTCAAGCAGCAAAGATGATTACTACTGTAATTACGATGATAGTAGTAGAAGGCATTTTGCAAGTGATGAGGATAGAGGCCGTTGGGTTGCTGAGCCTGGTATTGACCGGAAAGCTTCTGCTTTCATCGCTAGATTTTATGCCTCACGAGTCAGTGATTCTGAGCACCAAATTGCATCTTGA

Predicted protein sequences of Glyma17g04730

Limit To All Plant Sequences

>Glyma17g04730.2   sequence type=predicted peptide   gene model=Glyma17g04730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGAKKSSSSFSFCGMFKACFSSSKDDYYCNYDDSSRRHFASDEDRGRWVAEPGIDRKASAFIARFYASRVSDSEHQIAS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain