SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g04720

Feature Type:gene_model
Chromosome:Gm17
Start:3155653
stop:3158614
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g04720
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G28050AT Annotation by Michelle Graham. TAIR10: Cytidine/deoxycytidylate deaminase family protein | chr5:10044209-10045484 REVERSE LENGTH=204 SoyBaseE_val: 1.00E-111ISS
GO:0009061GO-bp Annotation by Michelle Graham. GO Biological Process: anaerobic respiration SoyBaseN/AISS
GO:0009218GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide metabolic process SoyBaseN/AISS
GO:0019690GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine deoxyribonucleoside interconversion SoyBaseN/AISS
GO:0019692GO-bp Annotation by Michelle Graham. GO Biological Process: deoxyribose phosphate metabolic process SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
KOG1018 KOG Cytosine deaminase FCY1 and related enzymes JGI ISS
PTHR11079Panther CYTOSINE DEAMINASE JGI ISS
PTHR11079:SF18Panther SUBFAMILY NOT NAMED JGI ISS
PF00383PFAM Cytidine and deoxycytidylate deaminase zinc-binding region JGI ISS
UniRef100_G7IQF5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cytidine deaminase n=1 Tax=Medicago truncatula RepID=G7IQF5_MEDTR SoyBaseE_val: 5.00E-115ISS
UniRef100_I1MS02UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MS02_SOYBN SoyBaseE_val: 8.00E-145ISS

Expression Patterns of Glyma17g04720
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g04720
ParalogEvidenceComments
Glyma13g17790 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g04720 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g042400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g04720
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g04720
>Glyma17g04720.1   sequence type=CDS   gene model=Glyma17g04720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTCATTTACTTCATTGTGTTTATTTATGTTTTTTTTTTCTTTTCTTTTTTATTACTTCAGTTGTGGAAACTAAGGATGGAACTGTCTCAGTAGCTGCTGCGTTTGCTGGTCATCAGGAAGCCGTGCAGGATAGAGACCACAAATTTTTAAGAAAAGCTGTTGAAGAAGCATATAAAGGGGTAGATTGCAAAGATGGAGGCCCTTTTGGTGCTGTTATAGTTCATAATGATGAAATAGTTGCTAGTTGTCACAACATGGTTCTGTGTAACACAGACCCAACTGCTCATGCTGAGGTGACAGCAATAAGAGAGGCTTGTAAGAAGCTTAAGCAGATAGAACTTGCAGATTGTGAAATATATGCTTCTTGTGAACCTTGCCCCATGTGCTTTGGTGCAATCCACCTTTCTCGAATTAAGAGGTTGGTTTATGGAGCGAAGGCTGAGGCAGCAATTGCTATTGGGTTTGATGATTTCATTGCAGATGCACTGCGAGGTACTGGATTCTATCAGAAAGCAACACTGGAAATTAAGAGAGCTGATGGTAATGAGGCCATCATTGCTGAAGAGGTTTTTGAGAAAACAAAGGAAAAATTCCAAATGTATTAG
Predicted protein sequences of Glyma17g04720
>Glyma17g04720.1   sequence type=predicted peptide   gene model=Glyma17g04720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFHLLHCVYLCFFFLFFFITSVVETKDGTVSVAAAFAGHQEAVQDRDHKFLRKAVEEAYKGVDCKDGGPFGAVIVHNDEIVASCHNMVLCNTDPTAHAEVTAIREACKKLKQIELADCEIYASCEPCPMCFGAIHLSRIKRLVYGAKAEAAIAIGFDDFIADALRGTGFYQKATLEIKRADGNEAIIAEEVFEKTKEKFQMY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo