Glyma17g04530 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g04530

Feature Type:	gene_model
Chromosome:	Gm17
Start:	3008695
stop:	3009674
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g04530

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G16820	AT	Annotation by Michelle Graham. TAIR10: vacuolar ATP synthase catalytic subunit-related / V-ATPase-related / vacuolar proton pump-related \| chr1:5757199-5758464 REVERSE LENGTH=93	SoyBase	E_val: 7.00E-13	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
UniRef100_D7TU14	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=D7TU14_VITVI	SoyBase	E_val: 3.00E-10	ISS
UniRef100_G7JJS9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein kinase-like protein n=1 Tax=Medicago truncatula RepID=G7JJS9_MEDTR	SoyBase	E_val: 1.00E-08	ISS

Expression Patterns of Glyma17g04530

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g04530 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma17g04530

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g04530

Limit To All Plant Sequences

>Glyma17g04530.1   sequence type=CDS   gene model=Glyma17g04530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCCACATATCAGATATTAAACTGATAAGAACAGATACTACACTTGATCTTAGCCAAAAGGCCGAGAAAGGTATGAGTTGTTCATGTTCCAGAGTTGCATTTTATAATAAAACATCAGTAGTTACCACCAGAGACTTGTCATTACAAAAACATTTCCATATAGCTGGAATGGTGGAAACAGCATTTTTATTATCTATGATATATGCTACTACTGATTTGATGGCCTACTATGGAATCATGATAAATGCCTGCTAA

Predicted protein sequences of Glyma17g04530

Limit To All Plant Sequences

>Glyma17g04530.1   sequence type=predicted peptide   gene model=Glyma17g04530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAHISDIKLIRTDTTLDLSQKAEKGMSCSCSRVAFYNKTSVVTTRDLSLQKHFHIAGMVETAFLLSMIYATTDLMAYYGIMINAC*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain